KEGG   Mycobacterium sp. JS623: Mycsm_06166Help
Entry
Mycsm_06166       CDS       T02423                                 

Definition
(GenBank) putative NAD(P)H quinone oxidoreductase, PIG3 family
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N adh_short
Motif
Other DBs
NCBI-ProteinID: AGB26320
UniProt: L0J459
Position
6113761..6114735
Genome map
AA seq 324 aa AA seqDB search
MRAIVAEAADQLTWQEVPDIAPEVGEILIEVSAAGVNRADLLQAAGNYPPPPGASQIIGL
EVSGTVAAVGDEVTQWAVGQQVCALLAGGGYAEFVAAPAGQVMPVPEGVPLQHAAALPEV
ACTVWSNLIMTADLAGGQLLLIHGGSSGIGTHGIQVARALGARVAVTAGAQNKLDLCTEL
GAEITINYRDEDFVERIRGEGGANVILDIMGAKYLDRNVDALATGGRLVIIGMQGGVTAE
LNIGKLLGKRAGVIATGLRSRPVTGPGSKTEIVEQVSANVWPMIANGQVRPIIGAEFPID
QAKAAHELLASGEVSGKILLRVGD
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcgatcgtggcggaagcagccgatcagctcacctggcaagaagtcccggacatc
gcgcctgaggtcggcgaaatcctcatcgaagtaagtgctgcgggtgtcaaccgagctgac
ctactgcaggcggccgggaactatccaccgcctcccggggccagccagatcatcggactc
gaggtgtccgggacagtcgcagcggtcggtgacgaagtcacccaatgggccgtcgggcaa
caagtctgtgctttgctggcaggcgggggctacgcggaatttgtcgccgctccggccggc
caggtgatgccggtgcccgaaggtgtgccgctacagcacgccgccgcgttacccgaagtg
gcctgcaccgtctggtccaacctgatcatgacggcggatttggccggcggtcaactgctg
ctgatccacggcggcagcagcggcatcggcacacatggcatccaggtggcgcgcgcgctc
ggggccagggtggccgtgacggcgggggcgcagaacaaactcgacctgtgcaccgagctt
ggcgccgaaatcaccatcaactaccgcgacgaagactttgtcgagcggatccgcggcgaa
ggcggcgcgaacgtgattctcgacatcatgggtgccaagtacctcgaccgcaatgtcgat
gcactggccacgggtgggcggttggtgatcatcgggatgcagggcggtgtgacggccgaa
ctcaacatcggcaagctgctcggcaagcgagccggcgtcatcgccacgggcttgcggtct
cgcccggttactgggcccggcagcaagactgagatcgtcgagcaggtgagcgccaacgtc
tggccgatgatcgccaacggtcaggtgcggccgatcatcggcgccgaattcccgatcgat
caggccaaggctgcgcatgagctgttggcctcgggtgaggtttcggggaaaatccttctg
cgcgttggtgattag

DBGET integrated database retrieval system