KEGG   Mycobacterium sp. JS623: Mycsm_06191Help
Entry
Mycsm_06191       CDS       T02423                                 

Definition
(GenBank) putative esterase
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(6159388..6160266)
Genome map
AA seq 292 aa AA seqDB search
MRGWIRALLTVVLAAGLWTATAPTAGAQVETLMVPSAAMGRDIPVAFQAGGPHMVVLLDA
FNAAPDVSNWVTAGNAMNTLAGKGISVAAPAGGAWSLYTDWEQDGSMQWETFLANELPDW
LAANKGLAPNGHGIVGAAQGGTGAMTIATFHPDRYRFAGSLSGFLTPSNTYTNGAITAGL
AQFGGVDTRNMWGLPQLGRWKWHDPDVHVQLLADNNTRLWVMSPSTLSCSDPAAMIGYCD
QAQGSNRTFYQHYRNVGGHNGHFDFPDGPQHDWGTWSGQLGAMSGELVTTIK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgggtggataagagcgctgttgaccgttgtgcttgccgcggggctgtggaccgcc
acggcaccgaccgccggcgcccaagtcgagacgctgatggtcccgtcggctgcgatgggg
cgcgacatccccgtcgcctttcaggccggcggcccgcacatggtcgtcctgcttgacgcg
ttcaacgccgcaccggacgtcagcaactgggtgacggcaggcaacgcgatgaacacgctc
gcgggcaagggcatctcggtggccgcgcctgccggcggcgcgtggagcctgtacaccgac
tgggagcaggacggctccatgcagtgggagacgttcctggccaacgagttgcctgactgg
ctggccgccaacaagggcctggcccccaacggccacggcatcgtcggcgcggcccaaggc
ggcacgggggcgatgacgatcgccacgttccatcccgaccgctaccgcttcgccggctcg
ctgtcgggtttcctcaccccgtccaacacctacaccaacggtgcgatcaccgccgggctg
gcgcagttcggcggcgtcgacacccgcaacatgtggggattgccacagctgggccggtgg
aagtggcatgaccccgacgtgcacgtgcaactgctggcagacaacaacacccggctgtgg
gtgatgagcccgtcgacgctgtcatgcagcgatccggccgcgatgatcggttactgcgat
caggcccagggcagcaaccgcacgttctaccagcactaccgcaacgtcggtgggcacaac
gggcacttcgacttccccgatggcccacaacacgactggggcacctggtcgggtcagctg
ggcgcgatgtcgggcgaactcgtcaccacgatcaagtag

DBGET integrated database retrieval system