KEGG   Mycobacterium sp. JS623: Mycsm_06193Help
Entry
Mycsm_06193       CDS       T02423                                 

Definition
(GenBank) putative esterase
  KO
K18851  
diacylglycerol O-acyltransferase / trehalose O-mycolyltransferase [EC:2.3.1.20 2.3.1.122]
Organism
msa  Mycobacterium sp. JS623
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mycsm_06193
Enzymes [BR:msa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     Mycsm_06193
    2.3.1.122  trehalose O-mycolyltransferase
     Mycsm_06193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(6161657..6162676)
Genome map
AA seq 339 aa AA seqDB search
MRRPSVVNTVPIRLRRLLAIAAALLTLPALSVSAAPHADAFSREGLPVEYLDIYSTSMGR
NIRVQFQPAVAPTTPAPAPAASSKAVYLLDGMRARDDYNGWDIETPAFEWFYNSGVAVVM
PVGGQSSFYSDWYSPSSFNNQGYTYKWETFLTSELPLWLANNKQVSMTGNGVVGLSMSGS
AALILSAYHPAQFKYAASLSGFLNPSALLMQQAIRVAMLDAGSYNVDNMWGAPWDSAWKR
NDPIKQVSRIVGNGTRLWIYCAPGGNSTVNPEPDPNQQFNADSLEGMAIKSNKDFQEAYA
KAGGNNATFVFPTAGNHAWPYWGQQLTSLKPDLIATLNG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaggccttcggtggtcaacactgtgcctattcggcttcgtcgcctgctggcgatc
gcggccgcgttgctgactcttccggcgctgtcggtcagcgccgcgccgcatgccgacgcg
ttctcgcgcgaaggtctgcccgtcgaatacctcgacatctactccacgtcgatgggccgc
aacatccgcgttcagttccagcccgccgtagcaccgaccacccccgcgcccgcaccggcg
gcttcgagcaaggccgtgtacctgctcgacgggatgcgtgcgcgtgacgactacaacggc
tgggatatcgaaacccccgcgttcgagtggttctacaactccggcgttgccgtggtgatg
cccgtcggcggacagtccagcttttactccgactggtactcgccgtcgagcttcaacaac
cagggctatacctataaatgggagacgtttctcaccagcgagcttccgctgtggcttgcg
aacaacaagcaagtctccatgacgggcaacggcgttgtcggactgtcgatgtcgggaagt
gcggcactcatcttgtctgcctaccacccggcgcagttcaaatatgccgcgtcgttgtcg
ggctttctgaatccgtcggcgctgttgatgcagcaggccatccgcgtcgcgatgctcgac
gcgggcagctacaacgtcgacaacatgtggggcgcgccttgggattccgcgtggaagcgc
aacgacccgatcaaacaggtgtcgcgcatcgtcggcaacggaacgcggctgtggatctac
tgcgcgcccggtggcaacagcaccgtcaacccggaacccgatccgaatcagcaattcaac
gctgacagccttgaaggcatggccatcaagagcaacaaggactttcaagaggcgtacgcc
aaggccggcggaaacaacgccacctttgtgtttccgaccgcgggtaaccacgcgtggccg
tactgggggcagcaattgacgtcattgaaaccagacctgatcgcgaccctcaacggctga

DBGET integrated database retrieval system