KEGG   Mycobacterium sp. JS623: Mycsm_06200Help
Entry
Mycsm_06200       CDS       T02423                                 

Definition
(GenBank) N-acetylmuramoyl-L-alanine amidase
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LGFP Amidase_2
Motif
Other DBs
NCBI-ProteinID: AGB26354
UniProt: L0J501
Position
6170908..6172074
Genome map
AA seq 388 aa AA seqDB search
MLKYVAAAPVILGLGAGAATLIKPPQAAAEPPWLTALNAPGQTPNIISRADWGADESMRS
GAPVYDDRVLAGIVHHTATPNEYAPEDGPGIVRSIYAYHTRSLGWSDIAYNALVDKYGQV
FEGRFGGITRPVQGSHTGGFNKNTWAVAMIGNFDLMEPTPIQLRAVGRLFGWRLAMDGVD
PMGSVALASAGGPYTRFPQGAVSTFPNIFAHRDVGSTECPGNLGYGSLDRIREIAARFDK
PANAQDLADSMRGSAIHTRWQSMGGMNSPLGAPTAPEASGAGSARYVTFDKGAIYWSPQC
GAQPLMGSIYNAWAMLGFERGALGLPTSGEIQEALWVVQNFQHGTLNLDREKGTVTRVID
GVPLELPPPPQEGPPVQLERFSPARNRV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaagtacgtcgcggctgcgcccgtcattctgggtttgggcgcaggcgctgcgacg
ctgatcaagccgccgcaagcggcggccgaaccgccgtggttgacggcactcaatgcgccc
ggtcagacacccaacatcatcagccgcgccgattggggagctgacgagtcgatgcggtcc
ggagcgccggtgtacgacgaccgggtactggcggggattgtgcaccacacagcaacgccc
aacgaatacgcacccgaagacgggccgggcatcgtcaggtcgatttacgcctatcacacc
cgctcactgggctggtccgacatcgcctacaacgcgctggtcgacaagtacggtcaggtc
ttcgagggcagattcggcggcataacgaggccggtccagggttcgcacactggcggtttc
aacaagaacacctgggctgtcgccatgatcggcaactttgatttgatggaaccgacgccg
atccagttgcgagcggttggccggctgttcggatggcgactggccatggatggcgtcgac
cccatgggcagcgtcgcgctggcctcggcaggcgggccctacacccgattcccgcagggc
gctgtctcaacctttccgaacattttcgctcatcgcgacgtcggcagtaccgagtgtcct
ggcaacctcggctatggatctctggatcggatccgcgaaatcgccgcccggttcgacaag
ccggccaacgcacaggatttggcggattccatgcggggcagcgcaattcacacacggtgg
cagtcgatgggcggaatgaacagcccgctcggtgctcccacagcccctgaagcatcgggt
gccggttcggcgcgctacgtcaccttcgacaagggagcgatttactggtcaccgcagtgc
ggagcacagccgctgatggggtcgatctacaacgcatgggccatgctcggcttcgagcgt
ggcgcgctcggcctgccgaccagcggggaaattcaggaggcactgtgggtggtgcagaat
ttccagcacggcacgctgaacctcgatcgcgagaagggcaccgtaacccgggtcattgac
ggcgttccgctcgaactaccgccaccaccgcaggaagggccgcccgtgcagcttgagcgg
ttctcaccggcgcgcaaccgcgtctga

DBGET integrated database retrieval system