KEGG   Mycobacterium smegmatis JS623: Mycsm_06294Help
Entry
Mycsm_06294       CDS       T02423                                 

Definition
nicotinamidase-like amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Mycsm_06294
Enzymes [BR:msa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Mycsm_06294
    3.5.1.-  
     Mycsm_06294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6255321..6255872
Genome map
AA seq 183 aa AA seqDB search
MRALIIVDVQNDFCEGGSLAVTGGSTVARGISELLAGDPGYAHVVATKDFHIDPGEHFAE
KPDYAASWPPHCVVGTSGADFHRDFNPAAVEAVFKKGHYSAAYSGFEGTDESGITLADWL
RERGVDEVDVVGIATDYCVRATAADAAEAGFSTRVLLDLTAGVAPDTTKKAVEELRAVGV
EVA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgctgatcatcgtcgacgttcagaacgacttctgtgagggcggctcactggcg
gtcacaggcggatccaccgtcgcgcgcgggatctccgagttgcttgccggcgatcccggc
tacgcccacgtcgtggcgaccaaggacttccacatcgaccccggtgagcacttcgccgag
aaacccgactatgcggcatcctggccaccgcattgcgtggtcggcacctctggtgcggac
ttccatcgcgacttcaaccctgccgccgtcgaggcggttttcaagaagggccactactcg
gcggcctacagcggcttcgagggcaccgatgagtccggtataacgctggcggactggctg
cgagagcgcggcgtcgacgaggtggacgtcgtcggcatcgccaccgactattgcgtgcgc
gccaccgccgccgacgcggctgaggcggggttttccacgcgggtgctgctcgacctcacc
gcgggcgtcgcaccggacaccaccaagaaggccgtcgaggagctgcgggcggtcggtgtc
gaggtggcttag

DBGET integrated database retrieval system