KEGG   Mycobacterium smegmatis JS623: Mycsm_06408Help
Entry
Mycsm_06408       CDS       T02423                                 

Definition
cellobiohydrolase A (1,4-beta-cellobiosidase A)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:msa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6360273..6361265)
Genome map
AA seq 330 aa AA seqDB search
MSAAGAVARWIAPLLTVVAIAGLAVAADPTPAPAVRLAADEGNPLAGASFYVNPTSTAMR
AAQKADPPSPELTAIANTPQAYWLVQGSSAATVAKYVGDAQAAGAMPVFALYGIPHRDCG
SFAAGGFATAADYKGWIDGIAADIGGSPAAIVVEPDALAMADCLSADQRQERYDLIRYAV
ETLTRNPAAAVYIDAGHLRWHSADEMAARLNQAGIAQARGFSLNTANFFTTEDEIGYGEA
ISGLTNGSHYVVDTSRNGAGPAPDSPLDWCNPSGRALGTPPTTATAGAHADAYLWIKRPG
ESDGSCNRGDPPAGNFVTEFAVNLARNAGH
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctgccggcgccgtcgcgcgctggatcgctcccctcctgaccgtggtggccatc
gctggcctggccgtcgcggccgacccgacgcccgccccggcggtgcggttggccgccgac
gagggaaacccgttggccggggcgtccttctacgtcaacccgacctcgacggccatgcgc
gccgcgcagaaagccgacccgccgagccccgagctgaccgcgatcgccaacacaccccag
gcgtactggctcgtgcagggctcgtcggcagcgacggtggcgaagtacgtcggtgacgcg
caggcggccggtgccatgccggtgttcgcgctctatggcatcccgcaccgtgattgcggc
agtttcgctgcgggagggttcgcgacggctgcggactacaaaggctggatcgacggtatc
gccgccgacataggcgggtcgcccgcggcgatcgtcgtcgaacccgatgccctcgccatg
gccgactgcctgtcggctgatcagcgccaggaacgctacgacttgattcgctacgccgtt
gaaaccctgactcgcaatccggccgcggccgtctacatcgacgccggccacctgcgctgg
cacagtgccgacgagatggccgcccggctcaaccaggctggtatcgcgcaggctcggggt
ttcagcctcaacaccgctaacttcttcaccaccgaagacgaaatcggttatggcgaagcg
atttcggggctgacgaatgggtcgcactacgtggtcgacacatcgcgcaacggcgcaggg
ccagcgcctgactccccgctcgactggtgcaacccaagcggacgggcactgggtactccg
ccaaccacggctaccgctggcgcgcacgccgacgcctacctgtggatcaaacgccccggt
gaatccgacggctcctgcaaccgcggtgatcccccggcgggcaacttcgtcactgaattc
gccgtcaatttggcccgcaacgcgggccactag

DBGET integrated database retrieval system