KEGG   Mycobacterium smegmatis MC2 155: LJ00_27295Help
Entry
LJ00_27295        CDS       T03433                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
msb  Mycobacterium smegmatis MC2 155
Pathway
msb00071  Fatty acid degradation
msb00072  Synthesis and degradation of ketone bodies
msb00280  Valine, leucine and isoleucine degradation
msb00310  Lysine degradation
msb00362  Benzoate degradation
msb00380  Tryptophan metabolism
msb00620  Pyruvate metabolism
msb00630  Glyoxylate and dicarboxylate metabolism
msb00640  Propanoate metabolism
msb00650  Butanoate metabolism
msb00900  Terpenoid backbone biosynthesis
msb01100  Metabolic pathways
msb01110  Biosynthesis of secondary metabolites
msb01120  Microbial metabolism in diverse environments
msb01130  Biosynthesis of antibiotics
msb01200  Carbon metabolism
msb01212  Fatty acid metabolism
msb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:msb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LJ00_27295
   00630 Glyoxylate and dicarboxylate metabolism
    LJ00_27295
   00640 Propanoate metabolism
    LJ00_27295
   00650 Butanoate metabolism
    LJ00_27295
  Lipid metabolism
   00071 Fatty acid degradation
    LJ00_27295
   00072 Synthesis and degradation of ketone bodies
    LJ00_27295
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LJ00_27295
   00310 Lysine degradation
    LJ00_27295
   00380 Tryptophan metabolism
    LJ00_27295
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LJ00_27295
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LJ00_27295
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LJ00_27295
Enzymes [BR:msb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LJ00_27295
Exosome [BR:msb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LJ00_27295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N DUF2560
Motif
Other DBs
NCBI-ProteinID: AIU10540
UniProt: A0R3M0 I7FKH8
Structure
PDB: 

Jmol
Position
complement(5609668..5611191)
Genome map
AA seq 507 aa AA seqDB search
MVDPRTPVIVGVGQFTERIDLDGYRGMSSVELATEAAKAALHDCGADADTVARAIDTVAG
TRQFEISGPASAPLGVSSNYPRSVARNIGADPAHAVLEVIGGQSPQHLATEFGGKIAAGE
NDVVLIFGSENTSTLRHFSKAENKPDHSETVDGQLEDRGYGYDGIFDEYTIRHGLIGAPV
QYGLLENARRARLGLSVADYRLAMAELFAPFSKVAAKNPYSSAPTERSVEELLTVTASNR
MIVDPYPRLMVARDQVNQGAALLMMSVESARKLGVPEEKWVYLRGHADMKEPKLLERADI
GASPASVTAVNEALRVAGIGLDDVAAFDLYSCFPFPVFNICDGTGLATDDPRGLTLTGGL
PFFGGLGNNYSMHGIAEAVNEMRDKPGQFALVGANGGIASKYSVGIYSTEPADWVADNSA
QLQAEHDAQPKVAITEKADGTGTIETYTVRYDWTPHTGIIIGRLDDGSRFLAKTKDEDLV
KLLSEGDPIGAKIVVTPGEKSNRAVLA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggtcgatccgcgtacgcctgtcatcgtcggcgtgggacagttcaccgaacgcatcgat
ctcgacggttatcggggcatgtcgtcggtcgagctggcgaccgaggccgcgaaggccgcc
ctgcatgactgcggggccgacgcggataccgtggcgcgcgccatcgacaccgtggcaggt
acccggcagttcgagatctccggcccggcatcggccccgctcggcgtctccagcaactac
ccgcgctcggtcgcgcgcaacatcggcgccgacccggcccatgccgtgctcgaggtgatc
ggcgggcagagcccgcagcacctcgcgacggagttcggcggcaagatcgcggccggtgag
aacgacgtcgtgctgatcttcggctcggagaacacctccacgctgcgccacttctccaag
gccgagaacaagccggaccactccgagaccgtcgacgggcagttggaggaccgcggctac
gggtacgacggaatcttcgacgagtacacgatccgccacggcctgatcggtgccccggtg
cagtacggccttctggagaacgcccgccgcgcccgcctgggcctctcggttgccgactat
cgcctcgcgatggccgagctgtttgccccgttctcgaaagtggccgccaagaacccgtat
tcgtcggcgccgacggagcgctcggtcgaggaactgctcaccgtcactgcatcgaatcgc
atgatcgtcgacccctacccgcgtctgatggtcgcgcgcgaccaggtgaaccagggtgcc
gcgctgctgatgatgtcggtggaatccgcacgcaaactcggtgtgcccgaagagaagtgg
gtgtacctgcgcgggcacgccgacatgaaggagcccaagctgctggagcgcgccgacatc
ggtgccagcccggcctcggtgaccgcggtgaacgaggcgctgcgcgtggccggtatcggc
ttggacgacgtggcggccttcgatctgtacagctgcttcccgttcccggtgttcaacatc
tgcgacggcacagggctggccaccgacgacccgcgtggcctcactctcaccggcggactg
ccgttcttcggcggcctgggcaacaactactcgatgcacggcatcgccgaggcggtcaac
gagatgcgtgacaagcccggtcagttcgcgctcgtcggcgccaacggcggcatcgccagc
aagtactcggtgggcatctactcgaccgagcccgccgactgggtcgccgacaacagcgcg
caactgcaggccgagcacgacgcgcagcccaaggtcgccatcaccgagaaggccgacggc
acaggcaccatcgagacctacaccgtgcgctacgactggacgccgcacaccggcatcatc
atcggccgtctcgacgacggcagccgcttcctggccaagaccaaggacgaggacctggtc
aagctgctcagcgagggcgacccgatcggcgcgaagatcgtcgtcacccccggcgagaag
agcaaccgcgccgtactggcgtaa

DBGET integrated database retrieval system