KEGG   Mycobacterium smegmatis MC2 155: LJ00_31835Help
Entry
LJ00_31835        CDS       T03433                                 

Definition
(GenBank) ribonuclease
  KO
K02553  
regulator of ribonuclease activity A
Organism
msb  Mycobacterium smegmatis MC2 155
Brite
Messenger RNA biogenesis [BR:msb03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     LJ00_31835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
6505266..6505745
Genome map
AA seq 159 aa AA seqDB search
MSIEPRATADLVDEIYPDVRSCDLQLQNYGGKIMFAGPVTTVRCFQDNALLKSILSTPGE
GAVLVVDGAGSLHTALVGDVIAGLAADNGWSGVIVNGAVRDAAALRTIDVGIKALGTNPR
KGTKTGEGERDVEVSFGGVTFTPGDIAYCDEDGIVVVTP
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgagtatcgaaccgcgcgccaccgccgacctcgtcgacgagatctatcccgacgtccgc
agctgtgacctgcaattgcagaactacggcggcaagatcatgttcgcaggcccggtcacc
acggtgcgctgcttccaggacaacgcgctgctgaagtcgatcctctcgacgccgggtgag
ggcgcggtgctcgtggtcgacggcgccggttccctgcacaccgcgctcgtcggcgacgtc
atcgccggtctggcggccgacaacggctggtccggtgtgatcgtcaacggtgcggtgcgc
gacgccgccgcgctgcgcaccatcgacgtcggtatcaaggcactcggcaccaacccccgc
aagggcaccaagaccggcgagggcgagcgcgatgtcgaggtcagcttcggcggcgtgacc
ttcacccccggcgacatcgcctactgcgacgaggacggcatcgtcgtcgttaccccctga

DBGET integrated database retrieval system