KEGG   Methylocystis sp. SC2: BN69_0060Help
Entry
BN69_0060         CDS       T02324                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
msc  Methylocystis sp. SC2
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:msc00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:msc00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
66008..67015
Genome map
AA seq 335 aa AA seqDB search
MRAFICGLKGPALEADERAFLRDAAPWGVILFRRNVDAPDQIARLTADIRDALGRHAPVL
VDQEGGRVQRLGPPHWRAYPAAARFERAAADAAQAERLAWLGARLIGHDLRSVGVDVDCL
PVLDAPAEDSHSIIGDRAYSRDPARVAAIGRAAAEGLMAGGVAPVMKHIPGHGRARADSH
LELPVVSARREDLELMDFAPFKANADLPMAMSAHVVYSAIDPAAPGTLSKAVIGDIVRSY
IGFDGLLMTDDLSMKALTGSFRERAERAIGAGCDLVLHCNGDLAEARPVAEGAPPLAGVA
LARAEKALECVRRPVESFDVAEATREFDAAMSAVA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccttcatctgtggattgaagggaccggcgctcgaggccgacgagcgcgcgttc
ctgcgggacgccgcgccttggggcgtgatcctttttcgccgcaatgtcgacgcgcccgat
cagatcgcgcggctgaccgccgacattcgggacgctctcggccgccacgcgcccgttctg
gtcgatcaggagggcggccgcgtccagcgcctgggaccgccgcactggcgcgcctatccg
gccgcggcgcgcttcgagcgggcggccgccgacgccgcgcaggccgagcgactcgcctgg
cttggcgcccggctgatcggccatgatctgcggtcggtcggcgtcgacgtcgactgcctg
ccggtgctcgatgcgcccgccgaggattcccacagcatcatcggcgatcgcgcctatagc
cgggatccggcgcgcgtcgccgcgatcggccgcgccgccgccgaagggttgatggcgggc
ggcgtcgcgccggtgatgaagcacattcccggtcacggacgcgcccgcgccgacagccac
ttggagctgccggtggtcagcgcgcgccgcgaggacctggagcttatggatttcgcgccg
ttcaaggcgaacgccgatctgccgatggcgatgagcgcccatgtcgtctattcggcgatc
gatccggcggctcccggcacgctctcgaaggcggtgatcggcgacatcgtccgcagctat
atcggtttcgacggcctcctgatgaccgacgacctgtccatgaaggcgctgacggggagc
ttccgtgagcgcgccgagcgggcgatcggcgccggatgcgatctcgtgctgcattgcaac
ggcgatctagcagaagcgcggccggtcgccgaaggcgcgccgccgctggcaggcgtggcg
ctggcgcgggccgaaaaggcgctcgaatgcgtgcggcggcccgtcgaatccttcgatgtc
gcggaggcgacgcgcgagttcgacgcggcgatgtcggcggtggcctga

DBGET integrated database retrieval system