KEGG   Methylocystis sp. SC2: BN69_0070Help
Entry
BN69_0070         CDS       T02324                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
msc  Methylocystis sp. SC2
Brite
Enzymes [BR:msc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BN69_0070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
74260..74943
Genome map
AA seq 227 aa AA seqDB search
MTERRAPNAAEYEERAALLLTLRQAGLRDLSVLRAMEATPREAFAPYRFRDLANRNLLLP
IGCGQTMSRPVELARRLEALKIGRGHRVLEVGAGSGYGAAALAQLASEVVSLERFETLAI
EASRRLAAHGVANAKAIFADGLDPPHELGRFDRIIVQASVGAAPAALIQMLTPGGALLFA
RREHAQAGARAKERLIKLDRNEDGELRETDLGPCRLGPAIPGLAQAL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcgccgcgcgcccaacgcagccgaatacgaggagcgcgcggcgctgctgctg
accttgcgccaggcggggctgcgcgacctctcggtgttgcgcgcgatggaggcgaccccg
cgggaggcgttcgcgccctatcgctttcgcgatctggcgaatcgcaatctcttgctgccg
atcggctgcgggcagaccatgtcgcgtccggtcgaactcgccagacggctcgaggcgctc
aagatcggccgcggccaccgggtgctggaggtcggggcggggtccggctatggcgcggcg
gcgctcgcgcagctcgccagcgaggtcgtaagcctcgaacgtttcgagacgctcgccatc
gaggcctcgcgccggttggccgcccatggcgttgcaaacgccaaggcgattttcgccgac
ggcctcgatccgcctcacgagctcggacgcttcgatcggatcatcgtccaggcctcggtc
ggcgccgcgcccgccgcgctcatccaaatgctcacgccgggcggcgcgctgctgttcgcc
cgcagggagcacgcgcaggccggcgcgcgggcgaaggaacgattgattaagcttgatcgc
aacgaggacggcgaactgcgcgagacggatcttggcccgtgtcgcctggggccggcgatc
cccggactggcgcaggcgctctaa

DBGET integrated database retrieval system