KEGG   Methylocystis sp. SC2: BN69_0308Help
Entry
BN69_0308         CDS       T02324                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
msc  Methylocystis sp. SC2
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BN69_0308
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN69_0308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(354497..354895)
Genome map
AA seq 132 aa AA seqDB search
MKTISLLTFAASVAFAASAGQALAAGDPAAGEKIFAKCKACHQVGETAKNAVAPQLNGIE
GRKAGSVEGYNYSEADKNSGIVWDEASFKEFIKNPKAKIPGTKMIFQGLPNEADQENVWA
YLVQFGPDGKKK
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaatttccctgctgacgttcgccgcgagcgtcgctttcgccgcatccgccggc
caggctctcgccgccggcgatccagctgcgggcgaaaagatcttcgccaagtgcaaagcc
tgccatcaggtcggcgaaaccgccaagaacgccgtcgcgcctcaactcaacgggatcgag
ggccgcaaggcgggctccgtcgaggggtacaactattccgaggccgacaagaattccggc
atcgtctgggacgaagccagcttcaaggagttcatcaagaatccgaaggcgaagattccc
ggcaccaagatgatcttccaaggcctgcccaacgaagcggaccaggagaacgtgtgggcc
tatctcgttcagttcggccccgacggcaagaagaagtaa

DBGET integrated database retrieval system