KEGG   Methylocystis sp. SC2: BN69_0341Help
Entry
BN69_0341         CDS       T02324                                 

Definition
lipolytic protein G-D-S-L family
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
msc  Methylocystis sp. SC2
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BN69_0341
Enzymes [BR:msc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BN69_0341
   3.1.2  Thioester hydrolases
    3.1.2.-  
     BN69_0341
Lipid biosynthesis proteins [BR:msc01004]
 Fatty acid synthase
  Component type
   BN69_0341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(385954..386664)
Genome map
AA seq 236 aa AA seqDB search
MIDAPRSTPTVQSPYCAFRRPLQAAALASLALLTIALTPARAEPVRILAFGDSLTAGPGI
DAADSLPAQLKRRLSEDGYNVEVVQGGVSGDTTTTGLARLDYTLGAGPFDIAVVELGAND
MLNGHDPKITRANLDRILATLKQKGVRPVLTAMVSSANHGQAYKKEFDSIYPDLAAKHEA
PLVPFILEGVWGSPALLISDGIHPNAVGVAKIVKKIAPYVERTLVSMGARRTSRAQ
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
ttgattgatgcgccgcgttcgacgcccacagtccagtcgccttattgcgctttccgccgt
cctctccaagccgcggctctcgcgtccttggccctgctgaccatcgcgctgacgcccgcg
cgcgccgaacccgtgcgaatcctggcgtttggcgacagcctgacggcggggcccggcatc
gacgccgcggattcgcttccggcgcaactcaagagacgcctgagcgaggacggatataat
gtcgaggtcgtccaggggggcgtttccggcgacacgacgacgaccgggctcgcgcgcctc
gactatacgcttggcgccgggccgttcgacatcgccgtcgtcgagctcggcgcgaatgac
atgctgaacgggcacgatccaaaaattacgcgcgccaatctcgatcggattcttgcgacc
ttaaagcagaaaggcgttcgcccggtgctgacggcgatggtctcgagcgcgaatcacggg
caagcttacaagaaggaattcgattcgatttatccggatcttgccgccaaacatgaggcg
ccgcttgtgccctttatcttggaaggcgtctggggctcgcccgcgctcctcatatcggac
ggcattcatcccaacgccgtcggcgtggcgaagatcgtcaaaaaaatcgcaccctatgtt
gaaagaacgctcgtttccatgggggcgcgtaggacctcgcgcgcgcaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system