KEGG   Methylocystis sp. SC2: BN69_0362Help
Entry
BN69_0362         CDS       T02324                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
msc  Methylocystis sp. SC2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(406409..407113)
Genome map
AA seq 234 aa AA seqDB search
MLDRVAQVTKTGEATATLRHTMVERQLRPFDVTDVPLLERFLETPREIFLPDSLAALAYS
DMAISVKGASGRKRSLLPPLVLARMLQSADVRATDRVLDIGGVGYSSALLCGLADKIVAL
ECDSGLAACAKAGLAALGCADVQLELGPLEKGYAGGAPYDVIIIHGRVQAGLEALFEQLT
PDGRLLAIVTPEPRAGQQVVRFERQDGRAAGELPLFSATAPVLDGFEEAPAFNL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgttggacagggtggcgcaagtgacgaagacgggcgaggcgacagcgactttgcgccac
accatggtcgagcgccagcttcgtccgttcgacgtgacggatgtgccgttgctggagcgc
ttcctcgagacgccgcgcgagattttcctgccggactccctcgccgcgctcgcctattcg
gatatggcgatctccgtgaaaggcgccagcggacgcaaacgcagcctgctgccgccgctg
gtgctggcccggatgcttcagagcgccgacgtcagagcgacggatagagtgctcgacatt
ggcggcgtgggctattcgtccgcactgctctgcggcctcgccgacaagattgtcgcgctg
gaatgcgattccggtcttgccgcctgcgccaaggctgggcttgcggcattgggctgcgcc
gacgtgcaactcgagctggggcctttggaaaagggctacgccggcggcgccccttacgac
gtcatcatcattcacggccgcgttcaggcgggactcgaggcgttgttcgaacagctgacg
cccgatggtcggctgctggcgatcgtcacgccggagccgcgcgccggccagcaggtcgta
cgcttcgagcgccaggacggccgcgcggcgggcgaactgccgttgttctcggcgacggcg
ccggtgctcgatggcttcgaagaggcgcccgccttcaacctctag

DBGET integrated database retrieval system