KEGG   Methylocystis sp. SC2: BN69_0368Help
Entry
BN69_0368         CDS       T02324                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
msc  Methylocystis sp. SC2
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:msc00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:msc00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(411866..412816)
Genome map
AA seq 316 aa AA seqDB search
MQSGAPPASFPHRHLLGIEGLTRPDIVTLLDMAEEAIEVSRRVDKKRSSLRGRTQINLFY
ESSTRTQASFEIAGKRLGADVMNMSVARSSESKGETLIDTAVTLNAMRPDIIVVRHAHAG
AAHLLARKVDCSVVNAGDGAHEHPTQALLDALTIRRNKGRIEGLTIAICGDILHSRVARS
NILLLGALGARVRVVGPSTLAPDSLSRLGVEVFHEMRRGLEDADIVMMLRLQRERMAGAM
TPSAREYFHFFGLDEEKLAYAAPDALVMHPGPMNRGVEIDTAVADSARSLIREQVEMGVA
VRMAVLEALAQHLPNV
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcaggggcgccgccagcttctttcccgcaccgccaccttctcggcatcgaagga
ttgacccgtcctgacatcgtcacccttctcgacatggccgaggaggcgatcgaagtgtcg
cggcgggtcgacaagaagcgttcgagtttgcgcgggcggacgcaaatcaatctgttttac
gaatcgtcgacgcgcacgcaggcgtccttcgagatcgccggcaagcgcctgggcgccgac
gtgatgaacatgtcggtcgcgcgctcctcggagtcgaaaggcgagacgctgatcgacacc
gcggtgacgctgaacgcgatgcgccccgacatcatcgtcgtgcgccatgcgcacgccggc
gcggcgcatcttctggcgcgaaaggtcgactgttccgtcgtcaacgccggcgacggcgcc
catgaacatcccactcaggcgctgctcgacgcgctgacgatcaggcggaacaagggccgc
atcgaggggctgacgatcgcgatttgcggcgacattctccattcgcgcgtcgcgcgctca
aacatcctgctgcttggcgcgcttggcgcgcgggtgcgcgtcgtcgggccttcgacgctt
gcgccggacagtctttcgcggctgggcgtcgaggtgtttcacgagatgaggcgcggactc
gaggacgctgacatcgtgatgatgctgcgccttcagcgcgagcgcatggccggcgcgatg
acgccgagcgcccgcgaatatttccacttcttcgggctcgacgaagagaagctcgcctat
gcggcgccggacgcgctggtgatgcatcccgggccgatgaaccgcggcgtggaaatcgac
accgccgtcgccgacagcgcgcgctcgcttattcgcgaacaggtcgagatgggcgtcgcg
gtgcgcatggcggtgctcgaagcgctcgcgcagcacctgccaaatgtgtaa

DBGET integrated database retrieval system