KEGG   Methylocystis sp. SC2: BN69_0368Help
Entry
BN69_0368         CDS       T02324                                 

Gene name
pyrB
Definition
(GenBank) Aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
msc  Methylocystis sp. SC2
Pathway
msc00240  Pyrimidine metabolism
msc00250  Alanine, aspartate and glutamate metabolism
msc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BN69_0368 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN69_0368 (pyrB)
Enzymes [BR:msc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BN69_0368 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: CCJ05819
UniProt: J7Q3I2
Position
complement(411866..412816)
Genome map
AA seq 316 aa AA seqDB search
MQSGAPPASFPHRHLLGIEGLTRPDIVTLLDMAEEAIEVSRRVDKKRSSLRGRTQINLFY
ESSTRTQASFEIAGKRLGADVMNMSVARSSESKGETLIDTAVTLNAMRPDIIVVRHAHAG
AAHLLARKVDCSVVNAGDGAHEHPTQALLDALTIRRNKGRIEGLTIAICGDILHSRVARS
NILLLGALGARVRVVGPSTLAPDSLSRLGVEVFHEMRRGLEDADIVMMLRLQRERMAGAM
TPSAREYFHFFGLDEEKLAYAAPDALVMHPGPMNRGVEIDTAVADSARSLIREQVEMGVA
VRMAVLEALAQHLPNV
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcaggggcgccgccagcttctttcccgcaccgccaccttctcggcatcgaagga
ttgacccgtcctgacatcgtcacccttctcgacatggccgaggaggcgatcgaagtgtcg
cggcgggtcgacaagaagcgttcgagtttgcgcgggcggacgcaaatcaatctgttttac
gaatcgtcgacgcgcacgcaggcgtccttcgagatcgccggcaagcgcctgggcgccgac
gtgatgaacatgtcggtcgcgcgctcctcggagtcgaaaggcgagacgctgatcgacacc
gcggtgacgctgaacgcgatgcgccccgacatcatcgtcgtgcgccatgcgcacgccggc
gcggcgcatcttctggcgcgaaaggtcgactgttccgtcgtcaacgccggcgacggcgcc
catgaacatcccactcaggcgctgctcgacgcgctgacgatcaggcggaacaagggccgc
atcgaggggctgacgatcgcgatttgcggcgacattctccattcgcgcgtcgcgcgctca
aacatcctgctgcttggcgcgcttggcgcgcgggtgcgcgtcgtcgggccttcgacgctt
gcgccggacagtctttcgcggctgggcgtcgaggtgtttcacgagatgaggcgcggactc
gaggacgctgacatcgtgatgatgctgcgccttcagcgcgagcgcatggccggcgcgatg
acgccgagcgcccgcgaatatttccacttcttcgggctcgacgaagagaagctcgcctat
gcggcgccggacgcgctggtgatgcatcccgggccgatgaaccgcggcgtggaaatcgac
accgccgtcgccgacagcgcgcgctcgcttattcgcgaacaggtcgagatgggcgtcgcg
gtgcgcatggcggtgctcgaagcgctcgcgcagcacctgccaaatgtgtaa

DBGET integrated database retrieval system