KEGG   Methylocystis sp. SC2: BN69_0421Help
Entry
BN69_0421         CDS       T02324                                 

Definition
pyrazinamidase/nicotinamidase, PncA protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
msc  Methylocystis sp. SC2
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BN69_0421
Enzymes [BR:msc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     BN69_0421
    3.5.1.-  
     BN69_0421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
466927..467499
Genome map
AA seq 190 aa AA seqDB search
MAGEAMRLNPGDALIVLDVQRDFCAGGALEVSGADEIVSVVNEMIEEAADAGVPIVASRD
WHPIGHASFRDCGGPWPAHCVQDSAGAQFHPDLRLPEQAVIVSKGATLERDQLSALNGTG
LAERLRRLGVRRLLIVGLALDVCVLETALDAVAEGFETHVRLSGARAITPEGGRDAVEKM
RMAGVFVEEC
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgaagcgatgcgcctgaaccctggcgacgcgctcatcgtcctggacgtgcag
cgcgatttctgcgccggcggcgccttagaggtttccggagccgacgagatcgtctccgtg
gtcaatgaaatgatcgaggaagccgcggacgccggcgttcccatcgtcgcgtcgcgggac
tggcatccaatcggccatgcgagttttcgcgactgcggcggaccatggccggcgcattgc
gttcaggacagcgccggcgcgcagttccatcccgatctgcgcctgcctgagcaggccgtc
atcgtcagcaagggagcgacgctcgagcgcgaccagctttcggcgctcaacggaacgggg
ctcgcggaacggctgcggcgtcttggcgtgcgtcgcctcctgattgtcggactggcgctg
gacgtctgcgtgctcgaaacggcgctggacgccgtcgcggaaggatttgaaacgcatgtg
cggctttccggcgcgcgcgccatcacgccggaaggcggaagagacgccgtcgaaaagatg
agaatggcgggcgtcttcgtggaggaatgctga

DBGET integrated database retrieval system