KEGG   Methylocystis sp. SC2: BN69_0588Help
Entry
BN69_0588         CDS       T02324                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
msc  Methylocystis sp. SC2
Brite
Enzymes [BR:msc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     BN69_0588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
634214..635173
Genome map
AA seq 319 aa AA seqDB search
MKTLLEDAKQNFRPIAVPSAANDSATAARIELGRRLFFENRVSMDGNVSCAHCHLPDKQA
SDGLPKAIGVFGKENPRNAPSVFNAALNFKQHWRGERESLEDQAEKSLLGPASFGNPDQA
TAMSKLKAVPAYAGAFAKAFPGDPDPINSKNWGVAVGAFERTLLTPSKFDAFLAGDVSAL
TKQQQAGLRKFIDLGCASCHNGAGVGGDSFQKFGVVSDYWKATGITTPDKGRADVSKNDA
DLYVFKVASLRNVAKTAPYFHDGSVDDLSKAVKIMGKTQLGQDLPEKDAADIVAFLGALT
GPVPANYSPPEPFPDAEGK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacgcttctggaggacgcaaaacagaatttccggccgatcgccgttccctccgct
gccaatgattcggcgacggcggcgcgaatcgagcttggtcgccggttgtttttcgaaaac
cgcgtgtcgatggacggcaacgtcagttgcgcgcattgtcatttgccggacaagcaggcg
agcgacgggctgccgaaggcgatcggcgtgttcggcaaggagaatccgcgcaatgcgccg
tcggtcttcaacgccgcgctgaatttcaagcagcattggcgcggcgaacgcgaatcgctc
gaagaccaggcggagaaatcgctgctcggccccgcgagcttcggcaatcctgatcaggcg
acggcgatgagcaagctgaaggcggttcccgcctacgccggcgccttcgccaaagcgttc
cccggcgatccggaccccatcaattcgaagaattggggcgtcgcggtcggcgccttcgag
cgcaccctgctgacgccctccaaattcgacgctttccttgcgggcgacgtctcggcgctc
acgaagcagcagcaggcgggcttgcgcaaattcatcgatctcggctgcgcctcctgccat
aatggcgcgggcgtcggcggcgattccttccagaaatttggcgtcgtgagcgactactgg
aaggcgacaggaataacgacgccggacaaaggccgcgccgacgtctccaagaacgacgcc
gacctttatgtcttcaaggttgcgagtctgcgcaacgtcgcgaaaaccgcgccctatttt
catgacggctccgtcgacgatctgagcaaagccgtgaaaatcatgggcaagacgcagctc
ggacaggatctcccggaaaaggacgcggcggacatcgtcgcctttctcggcgcgctgacg
gggccggttccggcgaattattcgccgccggagccttttccggacgcggagggaaagtag

DBGET integrated database retrieval system