KEGG   Methylocystis sp. SC2: BN69_0769Help
Entry
BN69_0769         CDS       T02324                                 

Definition
(GenBank) Phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
msc  Methylocystis sp. SC2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN69_0769
   00030 Pentose phosphate pathway
    BN69_0769
   00051 Fructose and mannose metabolism
    BN69_0769
   00052 Galactose metabolism
    BN69_0769
  Energy metabolism
   00680 Methane metabolism
    BN69_0769
Enzymes [BR:msc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BN69_0769
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     BN69_0769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
832078..833298
Genome map
AA seq 406 aa AA seqDB search
MTAIDFSKVLVAQGGGPTAVINQSLVGAVLESRKFREVERVYGAFHGVRGIVNEDFVDLT
QETTHNLELVACTPSSALGSTRDKPDLKYCQEIFRVLRAHGIGCFFYIGGNDSSDTVRIV
SQEAQSAGYPLRTVHIPKTIDNDLMVNDHTPGFPSAARWVAQAFAGANLDNWALPGVYIA
IVMGRHAGFLTAASALGKKFPDDGPHLIYIPERAFIVDKFLADVKATMAKYGRCVVAASE
GVCDENHTPIAEKLAKAVERDDHGNVHLGGGALADELTRLVKERLGFKRVRADTFGYVQR
SFVGCVSDVDQREAREVGEKAVQYAIWGDRDGSVTIHRTGFYSVDYHLTPLEEIAAKTKV
MPDEYISPCGTDVTDAFRMYLRPLLGSGMPDAYRLRLNRVPKILTA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccattgatttttctaaagtgctcgtcgctcagggcggcggccccaccgccgtc
atcaatcagtcgctcgtcggggccgtgctggagtcccgcaaatttcgcgaggtcgagcgc
gtctacggcgccttccacggcgttcgcggcatcgtcaacgaggatttcgtcgatctcacg
caggagacgacccataatctcgaactcgtcgcctgcaccccgtcttccgcgctcggctcg
acgcgcgacaagccggacctcaaatattgtcaggaaatcttccgcgtcctgcgcgcccat
gggatcggctgcttcttctatatcggcggcaatgattcctcggacacggtgcgcatcgtc
tcgcaggaggcccaaagcgccggctatccgctgcggacggtgcacattccaaaaaccatc
gacaacgatctgatggtcaacgaccacacgccgggcttcccctcggcggcgcgctgggtg
gcgcaggccttcgccggcgccaatctcgacaattgggccctccccggagtgtatatcgcg
atcgtcatgggccggcacgccggctttctgaccgccgcctcggcgctcggcaagaaattc
cccgacgacggcccgcatctcatctacatcccggagcgcgccttcatcgtcgacaaattc
ctcgccgacgttaaggcgacgatggcgaaatacggccgctgcgtcgttgcggcgtcagaa
ggcgtctgcgacgaaaaccacacccccatcgccgaaaagctggccaaggcggtggagcgc
gacgaccacggcaatgtgcatctgggcggcggcgcgctggccgacgaactcacccgcctc
gtgaaggaacggctcggattcaagcgggtacgggccgatacgttcggctatgtgcaaagg
agcttcgtcggctgcgtttccgacgtcgaccagcgcgaggcgcgcgaggtcggcgaaaag
gcggtgcaatacgccatttggggcgaccgcgacggctcggtgacgatccaccggaccggc
ttttattcggtcgactaccacttgacgccgcttgaagaaatcgccgcgaagacaaaagtg
atgccggacgaatatattagcccctgcggcacggacgtcaccgacgccttccggatgtat
ctgcgccccttgctcgggagcggcatgccggacgcctatcgcttgcggctcaatcgggtt
cccaagatactgaccgcctga

DBGET integrated database retrieval system