KEGG   Methylocystis sp. SC2: BN69_0769Help
Entry
BN69_0769         CDS       T02324                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
msc  Methylocystis sp. SC2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN69_0769
   01230 Biosynthesis of amino acids
    BN69_0769
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN69_0769
   00030 Pentose phosphate pathway
    BN69_0769
   00051 Fructose and mannose metabolism
    BN69_0769
   00052 Galactose metabolism
    BN69_0769
  Energy metabolism
   00680 Methane metabolism
    BN69_0769
Enzymes [BR:msc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BN69_0769
Protein phosphatases and associated proteins [BR:msc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BN69_0769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
832078..833298
Genome map
AA seq 406 aa AA seqDB search
MTAIDFSKVLVAQGGGPTAVINQSLVGAVLESRKFREVERVYGAFHGVRGIVNEDFVDLT
QETTHNLELVACTPSSALGSTRDKPDLKYCQEIFRVLRAHGIGCFFYIGGNDSSDTVRIV
SQEAQSAGYPLRTVHIPKTIDNDLMVNDHTPGFPSAARWVAQAFAGANLDNWALPGVYIA
IVMGRHAGFLTAASALGKKFPDDGPHLIYIPERAFIVDKFLADVKATMAKYGRCVVAASE
GVCDENHTPIAEKLAKAVERDDHGNVHLGGGALADELTRLVKERLGFKRVRADTFGYVQR
SFVGCVSDVDQREAREVGEKAVQYAIWGDRDGSVTIHRTGFYSVDYHLTPLEEIAAKTKV
MPDEYISPCGTDVTDAFRMYLRPLLGSGMPDAYRLRLNRVPKILTA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccattgatttttctaaagtgctcgtcgctcagggcggcggccccaccgccgtc
atcaatcagtcgctcgtcggggccgtgctggagtcccgcaaatttcgcgaggtcgagcgc
gtctacggcgccttccacggcgttcgcggcatcgtcaacgaggatttcgtcgatctcacg
caggagacgacccataatctcgaactcgtcgcctgcaccccgtcttccgcgctcggctcg
acgcgcgacaagccggacctcaaatattgtcaggaaatcttccgcgtcctgcgcgcccat
gggatcggctgcttcttctatatcggcggcaatgattcctcggacacggtgcgcatcgtc
tcgcaggaggcccaaagcgccggctatccgctgcggacggtgcacattccaaaaaccatc
gacaacgatctgatggtcaacgaccacacgccgggcttcccctcggcggcgcgctgggtg
gcgcaggccttcgccggcgccaatctcgacaattgggccctccccggagtgtatatcgcg
atcgtcatgggccggcacgccggctttctgaccgccgcctcggcgctcggcaagaaattc
cccgacgacggcccgcatctcatctacatcccggagcgcgccttcatcgtcgacaaattc
ctcgccgacgttaaggcgacgatggcgaaatacggccgctgcgtcgttgcggcgtcagaa
ggcgtctgcgacgaaaaccacacccccatcgccgaaaagctggccaaggcggtggagcgc
gacgaccacggcaatgtgcatctgggcggcggcgcgctggccgacgaactcacccgcctc
gtgaaggaacggctcggattcaagcgggtacgggccgatacgttcggctatgtgcaaagg
agcttcgtcggctgcgtttccgacgtcgaccagcgcgaggcgcgcgaggtcggcgaaaag
gcggtgcaatacgccatttggggcgaccgcgacggctcggtgacgatccaccggaccggc
ttttattcggtcgactaccacttgacgccgcttgaagaaatcgccgcgaagacaaaagtg
atgccggacgaatatattagcccctgcggcacggacgtcaccgacgccttccggatgtat
ctgcgccccttgctcgggagcggcatgccggacgcctatcgcttgcggctcaatcgggtt
cccaagatactgaccgcctga

DBGET integrated database retrieval system