KEGG   Methylocystis sp. SC2: BN69_0769Help
Entry
BN69_0769         CDS       T02324                                 

Definition
(GenBank) Phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
msc  Methylocystis sp. SC2
Pathway
msc00010  Glycolysis / Gluconeogenesis
msc00030  Pentose phosphate pathway
msc00051  Fructose and mannose metabolism
msc00052  Galactose metabolism
msc00680  Methane metabolism
msc01100  Metabolic pathways
msc01110  Biosynthesis of secondary metabolites
msc01120  Microbial metabolism in diverse environments
msc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN69_0769
   00030 Pentose phosphate pathway
    BN69_0769
   00051 Fructose and mannose metabolism
    BN69_0769
   00052 Galactose metabolism
    BN69_0769
  Energy metabolism
   00680 Methane metabolism
    BN69_0769
Enzymes [BR:msc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BN69_0769
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     BN69_0769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: CCJ06220
UniProt: J7QQI2
Position
832078..833298
Genome map
AA seq 406 aa AA seqDB search
MTAIDFSKVLVAQGGGPTAVINQSLVGAVLESRKFREVERVYGAFHGVRGIVNEDFVDLT
QETTHNLELVACTPSSALGSTRDKPDLKYCQEIFRVLRAHGIGCFFYIGGNDSSDTVRIV
SQEAQSAGYPLRTVHIPKTIDNDLMVNDHTPGFPSAARWVAQAFAGANLDNWALPGVYIA
IVMGRHAGFLTAASALGKKFPDDGPHLIYIPERAFIVDKFLADVKATMAKYGRCVVAASE
GVCDENHTPIAEKLAKAVERDDHGNVHLGGGALADELTRLVKERLGFKRVRADTFGYVQR
SFVGCVSDVDQREAREVGEKAVQYAIWGDRDGSVTIHRTGFYSVDYHLTPLEEIAAKTKV
MPDEYISPCGTDVTDAFRMYLRPLLGSGMPDAYRLRLNRVPKILTA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccattgatttttctaaagtgctcgtcgctcagggcggcggccccaccgccgtc
atcaatcagtcgctcgtcggggccgtgctggagtcccgcaaatttcgcgaggtcgagcgc
gtctacggcgccttccacggcgttcgcggcatcgtcaacgaggatttcgtcgatctcacg
caggagacgacccataatctcgaactcgtcgcctgcaccccgtcttccgcgctcggctcg
acgcgcgacaagccggacctcaaatattgtcaggaaatcttccgcgtcctgcgcgcccat
gggatcggctgcttcttctatatcggcggcaatgattcctcggacacggtgcgcatcgtc
tcgcaggaggcccaaagcgccggctatccgctgcggacggtgcacattccaaaaaccatc
gacaacgatctgatggtcaacgaccacacgccgggcttcccctcggcggcgcgctgggtg
gcgcaggccttcgccggcgccaatctcgacaattgggccctccccggagtgtatatcgcg
atcgtcatgggccggcacgccggctttctgaccgccgcctcggcgctcggcaagaaattc
cccgacgacggcccgcatctcatctacatcccggagcgcgccttcatcgtcgacaaattc
ctcgccgacgttaaggcgacgatggcgaaatacggccgctgcgtcgttgcggcgtcagaa
ggcgtctgcgacgaaaaccacacccccatcgccgaaaagctggccaaggcggtggagcgc
gacgaccacggcaatgtgcatctgggcggcggcgcgctggccgacgaactcacccgcctc
gtgaaggaacggctcggattcaagcgggtacgggccgatacgttcggctatgtgcaaagg
agcttcgtcggctgcgtttccgacgtcgaccagcgcgaggcgcgcgaggtcggcgaaaag
gcggtgcaatacgccatttggggcgaccgcgacggctcggtgacgatccaccggaccggc
ttttattcggtcgactaccacttgacgccgcttgaagaaatcgccgcgaagacaaaagtg
atgccggacgaatatattagcccctgcggcacggacgtcaccgacgccttccggatgtat
ctgcgccccttgctcgggagcggcatgccggacgcctatcgcttgcggctcaatcgggtt
cccaagatactgaccgcctga

DBGET integrated database retrieval system