KEGG   Methylocystis sp. SC2: BN69_0864Help
Entry
BN69_0864         CDS       T02324                                 

Gene name
folE2
Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
msc  Methylocystis sp. SC2
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:msc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(936339..936968)
Genome map
AA seq 209 aa AA seqDB search
MDDVVKTCPFSSLETVRTVERPSRDEAEAAVRTLLRWAGDDPDREGLRDTPRRVVKAYEE
FFSGYRESADEVLSKVFEEVEGYDDLVLVRDIPFTSHCEHHVVPFVGKTHIAYYPAGGVV
GLSKLARLVEIFARRLQTQEAMTAQIAAAIDEALAPRGVAVMVEAEHMCMSMRGVMKQGS
STVTMQFSGVFRDDPAEQARFYTLLRGAQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggatgacgtggttaagacctgtcccttttcttcgctcgagacggtgagaaccgtcgaa
cgcccctcccgcgatgaagccgaagccgccgtgcgcacgctgttgcgctgggcgggcgac
gatccggaccgcgaggggctgcgcgacaccccgcgtcgcgtcgtcaaagcctatgaagag
tttttcagcggctatcgggagagcgccgacgaggttctgtcgaaagtcttcgaggaggtc
gaaggctacgatgatctcgtgctcgttcgcgacattcccttcacctcgcattgcgagcac
catgtcgtgcccttcgttggaaagacgcacatcgcctattatccggcgggcggggtggtc
ggtctgtcgaagcttgcccggcttgtcgagatttttgcccggcggctgcagactcaggag
gcgatgacggcgcagatcgcggcggcgatcgacgaagcgctcgcgccgcgcggggtcgcc
gtgatggtcgaggcggaacatatgtgcatgtcgatgcgcggcgtgatgaagcagggatcg
tccacggtcaccatgcagttttctggcgttttccgcgacgatccggccgagcaggcgcgt
ttctatacgctgctgcgcggggcgcagtga

DBGET integrated database retrieval system