KEGG   Methylocystis sp. SC2: BN69_0996Help
Entry
BN69_0996         CDS       T02324                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
msc  Methylocystis sp. SC2
Pathway
msc00010  Glycolysis / Gluconeogenesis
msc00020  Citrate cycle (TCA cycle)
msc00620  Pyruvate metabolism
msc01100  Metabolic pathways
msc01110  Biosynthesis of secondary metabolites
msc01120  Microbial metabolism in diverse environments
msc01130  Biosynthesis of antibiotics
msc01200  Carbon metabolism
Module
msc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN69_0996
   00020 Citrate cycle (TCA cycle)
    BN69_0996
   00620 Pyruvate metabolism
    BN69_0996
Enzymes [BR:msc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BN69_0996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: CCJ06447
UniProt: J7Q7W5
Position
complement(1065567..1066667)
Genome map
AA seq 366 aa AA seqDB search
MNIFRLPDLGEGLQEAELVEWRVAAGEDVKVDQPLVAVETAKAVVEIPSPQGGRIERLFA
SAGDVIRIGAPLVGFEGAGEDTGSVVGAVQQGAGVVRDQPISVGHVGGAVRATPAVRALA
RKLNVDLAMVTPSGVDGLITTQDIERVARILSETEAAEPLRGVRRAMAHNMAQAQAEVAA
ATIVDDADIHAWAAGTDTTIRLIRALVQACKAEPALNAWFEPHAFARRVMKKIDLGVAVD
LSEEGLFVPVLRDVGNRDAQDLRKGLDRLRQDAAARRIPPEELRGATITLSNFGMIAGRY
AAPIVLPPTVAILGAGRIRDEVVAVDGAPAVHRILPLSLTFDHRVVTGGEAGRFLGAAIA
DLTRAS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaacatctttcgtcttcccgatctcggagaggggttgcaggaggccgaactcgtcgaa
tggcgtgtcgccgccggcgaggacgttaaagtcgatcagccgctcgtggcggttgaaacc
gccaaggcggtcgttgaaatcccatcgcctcaaggaggccgcatcgagcggctgttcgcc
tccgcgggcgacgtgatccgcatcggcgcgccgctggtcggttttgagggcgcgggagag
gacacggggtcagtggtcggcgccgttcagcagggggccggcgtcgtccgcgaccagccg
atctcggtcggccatgtcggcggcgcggtgcgggcgacgcccgccgtaagagcgctcgcg
cgaaaactgaacgtcgatctcgccatggtgacgccctccggcgtggacgggttgatcacc
acgcaggacattgagcgcgtcgcgcgcattctcagtgagacggaagccgccgagccgctg
cgcggcgtgcgccgggccatggcccacaatatggcgcaggcgcaggcggaagtggccgcg
gccacaatcgtcgacgacgcagacatccacgcttgggcggccgggacggatacaaccatc
cgtctgatccgcgctctcgtccaggcctgcaaggcggagcctgcgctcaacgcctggttc
gagcctcatgccttcgcgcgccgtgtgatgaagaagatcgaccttggcgtcgccgtggat
ctgtcggaagagggcctgttcgtgcctgtgctgcgggatgtcggcaatcgcgacgcgcag
gacttgcgcaagggcctcgaccgcctgcggcaggacgcggcggcgcgccgcataccgccc
gaggagctgcgcggcgcgaccatcacgctgtcgaatttcggcatgatcgcggggcgctac
gccgcgccgatcgtgctgccgccgacggtcgcgattctcggcgccgggcgcattcgcgat
gaggttgtcgccgtcgacggcgcgcccgccgtgcatcggattttgcctctgagcctcacc
ttcgatcaccgcgtggtcaccggcggcgaagccggccgcttcctgggggcggcgatcgcc
gatctgacgcgcgcgtcataa

DBGET integrated database retrieval system