KEGG   Methylocystis sp. SC2: BN69_1001Help
Entry
BN69_1001         CDS       T02324                                 

Definition
enoyl-CoA hydratase/isomerase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
msc  Methylocystis sp. SC2
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BN69_1001
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN69_1001
   00650 Butanoate metabolism
    BN69_1001
  Lipid metabolism
   00071 Fatty acid degradation
    BN69_1001
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN69_1001
   00310 Lysine degradation
    BN69_1001
   00360 Phenylalanine metabolism
    BN69_1001
   00380 Tryptophan metabolism
    BN69_1001
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN69_1001
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN69_1001
   00281 Geraniol degradation
    BN69_1001
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN69_1001
   00627 Aminobenzoate degradation
    BN69_1001
   00930 Caprolactam degradation
    BN69_1001
Enzymes [BR:msc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN69_1001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1071214..1072302)
Genome map
AA seq 362 aa AA seqDB search
MDLIASREGRLGRILLNRPQALNTLTLPMVREFRRALDDFGRDASVCAVLVTGAGDRGLC
AGGDVRILYELEPSHKRLFADFWREEYELNARIASFPKPYVAIMDGVVMGGGVGISAHGN
RRVVTERSRVAMPEVGIGFFPDVGATWLLSRAREIGAYLALSATSVAAADAIEAGLADVL
IHAEDIQPLIDRLATIQDGADVDVALRRLARHPGSGRLSLHRRLLAEATAYEKVDDVIAA
FEREGSEFSLRAAEDIGAKSPTALKATRALLLRAAGAPDVETCLTNEFKAACRMLATHDL
YEGIRAAIIDKDRRPSWSPDRLDAVSDETVEDILGGDDTPLPTFKSWDQTPYSAWRGSFA
SR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggatctcatcgcttcgcgcgagggccgtctcggacgcatcctcctcaacagaccacag
gcgctcaacacgttgacgctgccgatggtgcgcgagttccgacgcgcccttgacgacttt
gggcgcgacgcgagcgtttgcgccgtgctcgttacaggcgccggcgatcgcggactatgc
gccggcggcgacgtgaggattctctacgaactggaaccctcgcacaaacggcttttcgcc
gacttttggcgcgaggaatatgagctgaacgcccgcatcgcctccttccccaagccctat
gtcgcgatcatggatggcgtcgtgatgggcggcggcgtgggcatatctgcgcatggcaac
cggcgagtggtcacggagcgaagccgcgtcgcgatgccggaggtcggcatcggattcttt
cctgacgtgggcgcgacctggcttctttcgagagcgcgcgaaatcggcgcctatctggcg
ctttcggcgacgtcggtggcggcggcggacgcgatagaggccggtcttgcggatgttcta
atccatgcggaggacattcagccgctgatcgacaggctggcgacgatacaagacggcgcc
gacgtcgatgttgcgttgcggcgcctcgcccgccatccggggagcggccgactttcgctg
cacaggcgattgcttgccgaagcgaccgcatatgagaaggtcgatgacgtcatcgcggcc
ttcgagcgtgaagggtcggaattctcgttgcgtgcggcggaggacatcggcgcgaagtcg
ccgacggcgctgaaagcgacgcgcgcattgctgctgcgcgccgcgggcgcgcctgacgtc
gagacgtgtctcacgaacgaattcaaggcggcgtgccgcatgctggcgacccacgacctt
tatgaaggcatccgcgccgcgatcatcgacaaggaccggcgcccgagttggtcgccggat
aggcttgacgccgtgagcgacgaaaccgtcgaagacattctcggcggggacgacacgccc
ctcccgacgttcaaaagctgggatcagacgccatattctgcctggaggggctcgttcgcc
agccgatga

DBGET integrated database retrieval system