KEGG   Methylocystis sp. SC2: BN69_1040Help
Entry
BN69_1040         CDS       T02324                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
msc  Methylocystis sp. SC2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN69_1040 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN69_1040 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BN69_1040 (trpA)
Enzymes [BR:msc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BN69_1040 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1113447..1114313
Genome map
AA seq 288 aa AA seqDB search
MPTRIDDRFAALKKEGRAALVTFVMAGDPDLATSLDILRGLPGAGADVIEVGMPFTDPMA
DGPAIQAAGLRALKAGTTLKKTLKLVADFRAGDDATPIVLMGYYNPIYVYGVDAFLRDAR
DAGVDGLIVVDLPPEEDAELCVPARDAGLNFIRLATPTTDDKRLPKVLENTSGFVYYVSL
TGITGAALADYAGVSQAVARIKRHTALPIAVGFGVKNAENAAEIARNADGVVVGTALVQA
LKASLDAEGRAGPSSVGAVTGLVASIAEGVRDARPKGGVLSWLTRLVS
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcccacccgcatcgatgatcgcttcgccgccctcaagaaggaagggcgcgccgccctc
gtgacctttgtgatggccggcgacccggatctcgcgacgtcgctcgacatcttgcgcggc
ctgcccggcgccggcgcggacgtcatcgaagtcggcatgcctttcaccgatccgatggcg
gatgggccggcgatccaggcggcgggcctgcgcgcgctcaaggccgggaccacgctcaag
aagaccttgaagctggtcgccgacttccgcgccggagacgacgccacccccatcgtgctg
atgggctactacaatccgatctatgtctacggcgtcgacgccttcctgcgcgacgcccgg
gacgccggcgtcgacggcctgatcgtcgtggacctgccgcccgaagaagacgccgaactc
tgcgttcccgcgcgcgacgccgggctgaacttcattcgcctcgcgacgccgacgaccgac
gacaagcggcttcccaaggtgctcgaaaatacaagcggcttcgtctattatgtgtcgctc
accggcatcaccggcgcggcgctcgccgactacgccggcgtcagtcaggcggttgcgcgc
atcaagcggcacacggcgctgccgatcgccgtcggatttggcgtcaagaatgcggagaac
gccgctgagatcgcccgcaacgccgatggcgtcgtcgtcggcacggcgctggtccaagcg
cttaaggcctcgctcgacgccgagggccgcgccgggccgtcgagcgtgggcgcggtgacc
gggctcgtcgcgtccatcgccgaaggcgtgcgcgacgcccgccctaagggcggcgtgttg
agttggctgacgaggctcgtgtcatga

DBGET integrated database retrieval system