KEGG   Methylocystis sp. SC2: BN69_1128Help
Entry
BN69_1128         CDS       T02324                                 

Definition
Agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
msc  Methylocystis sp. SC2
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BN69_1128
Enzymes [BR:msc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BN69_1128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1204804..1205724)
Genome map
AA seq 306 aa AA seqDB search
MSGAPTFAAPPTFLGVAPRADAAVVVAGVPFDIGTTNRSGARFGPSAIRHASRMLIDGAH
PAHWTSPVDLPLADVGDFAIALGDIAASLKLIEEQASAYAHLVTLGGDHGITLPLLRACA
RKRGPLALIHFDAHVDTWPDNFGQPYAHGSMFYHAINEGVLDARRMIQIGIRSPVQRDVY
DWTLGQGVTIVAAQQAHEIGPAAVASRIVEVVGDAPVYMTFDVDALDPAFAPGTGTPEIG
GLATWQAQSIIRKLAGLNFIGMDVVEVAPAYDVSEITALAGATMVWEYLCLLAASAGSSR
SAARSP
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggggcgccgacattcgccgcgccgccgaccttcctcggcgtcgccccgcgcgct
gacgcggcggtcgtcgtcgccggagtccccttcgacatcggcacgaccaaccgcagcggc
gcgcgcttcgggccgtcggcgattcgtcacgccagccgtatgttgatcgacggcgcgcac
cccgcgcactggacgtcccccgtcgatctgccgctcgccgacgtgggggatttcgccatc
gcgctgggcgacatcgccgcaagtctcaagctcatcgaagagcaggcctcggcctatgcg
catctcgtgacgctgggcggcgaccatggaatcacgctgcctctgctgcgcgcctgcgca
agaaagcgcggaccgctggcgctgattcatttcgacgcccatgtcgatacatggcccgac
aatttcggccagccctatgcgcatggctcgatgttctatcatgcgatcaacgaaggcgtc
ctcgatgcgcgccgcatgattcagatcggcattcgctcgccggtgcaacgcgacgtctat
gactggacgcttggacaaggcgtcacgatcgtcgccgcgcagcaggcgcatgagatcggg
ccagcggcggtcgcctcgcggatcgtcgaagtcgtcggcgacgccccggtctatatgacg
ttcgacgtcgacgcgcttgatccggccttcgccccgggaaccggcacgccggaaatcggc
ggcctggccacctggcaggcgcagtcgatcatccgcaagctcgctggtctgaacttcatc
gggatggacgtcgtcgaggtggcgccggcctatgacgtttccgaaatcaccgcgctcgcc
ggcgcgaccatggtctgggaatatctctgcctgctggcggcgtcagccggttcgtcccga
tccgccgcgcggtctccttag

DBGET integrated database retrieval system