KEGG   Methylocystis sp. SC2: BN69_1235Help
Entry
BN69_1235         CDS       T02324                                 

Definition
beta-galactosidase (Beta-gal) (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
msc  Methylocystis sp. SC2
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BN69_1235
Enzymes [BR:msc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BN69_1235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1313031..1314989
Genome map
AA seq 652 aa AA seqDB search
MTRQRLGVCYYPEHWPQSRWSDDAAMMKEIGLSLVRIGEFAWSRLEPNAGAYRFEWLGDA
IDTLHRAGLKVVLGAPTATPPKWLVDKMPEMAALDADGRPRKFGSRRHYCFSHEGYAQEC
ERIVERLARAFGGHPAVVAWQTDNEFGCHDTVLSYSPAALQAFRRWCEAKYRSIETLNTA
WGNVFWSMEYRSFDAIELPNLTVTEANPSHLMDFQRFSSDQVVAFNRRQAQIIRRHAPGA
TILHNFMGAFVDFDHYALSDDLDIAAWDSYPLGFLERSSHDDDFKLRYMRVGDPDFQAFH
HDLYRACGRGRWQVMEQQPGAVNWAPWNPAPAKGAVRLWTFEAFAAGAEAVSYFRWRQAP
FAQEQMHEALLLPNAAPNEAYDDVARMSKELAMLDARVETARAPVALIFDYESAWAWRIQ
PQGQDFSYFDLVMCFYRALRRAGLSVDVIPPTAAAIADRRLIIAPALFAPSDNFAEALAK
SGASILLGPRTGSKTADFQIPADLPPGVLRRIIDIRVRRVESLRPGARVPVSAQGAFVRW
REFLTLGESVAPEFTSEDGETALARSDNVFYLAGWPDEELLTSVLRRVFVVAGISTLALP
EDIRVRDNGAMRYIFNYGATTTDISALIGDETLSLGERLLEPCGVAAFRRRG
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtcaacgccttggcgtttgctactatcctgaacattggccgcagtcacgctgg
agcgacgacgcggccatgatgaaggagataggtctttcccttgttcggattggcgaattc
gcctggtcgcggctggagccgaacgcgggcgcctatcgtttcgaatggctgggcgacgcc
atcgatacgctacatcgcgccggcctcaaagtcgtgcttggcgcgccgacggcgacgccg
cccaaatggctcgtcgacaagatgccggagatggcggcgctcgacgccgatgggcggccg
cgcaaattcggttcgcgccggcattattgtttcagccacgaaggctacgctcaagaatgc
gagcgcatcgtcgagcgtttggcgagagccttcggcggccatcccgcagtcgtggcgtgg
cagaccgacaatgaatttggctgccacgacactgtgctgagctattcgccggccgcgctg
caggcgtttcggcgatggtgcgaggctaaatatcgctcgatcgagacgctgaacaccgcc
tggggcaatgtcttctggtcgatggaatatcgaagcttcgacgcgatcgagctgccgaat
ctgaccgtcaccgaagccaatccgtcgcatctgatggattttcagcgtttctcgtccgat
caggtcgtcgccttcaaccggcgccaagcgcagatcatccggcgtcatgcgccgggcgcg
acgatcctccataatttcatgggcgcgttcgtcgactttgatcactatgcgctgtcggat
gatctcgatatcgccgcatgggacagctatccgctcggctttctcgaacgttcgtctcac
gacgacgatttcaagctgcgctacatgcgcgtcggcgatcctgactttcaggcctttcat
catgatctctaccgcgcgtgcgggcgcggccgatggcaggtgatggagcagcagccgggc
gccgtgaattgggcgccgtggaatccagcccccgcgaaaggcgccgtgcggctctggacc
ttcgaggctttcgccgccggcgccgaggcggtgagttattttcgctggcggcaggcgcct
ttcgcgcaagagcagatgcatgaagcgctgctgctgccgaacgccgcgccgaacgaagcc
tatgatgacgtcgcgcgcatgtcgaaggagctcgccatgctcgatgcgcgcgtcgaaacg
gcgcgcgcgccagtggcgctgatcttcgactatgagagcgcctgggcgtggcgcatccag
ccgcaaggccaggacttctcctatttcgatctcgtcatgtgcttctatcgggcgctgcgg
cgcgcggggctttccgtcgacgtcattccgccgaccgcggcggcgatcgccgatcgaagg
ctgatcattgcccccgcgctttttgcgccgtctgacaacttcgcagaggcgctggcgaaa
agcggcgcgagcatcctgctcggtccgcgcacgggatcgaagacggccgattttcaaata
ccggcggatctccctcccggcgttttgcgacgcatcatcgacattcgcgtcagacgtgtc
gaaagccttcggcccggcgcaagagttccggtctccgcacaaggcgctttcgtgcgttgg
cgagaatttttaactctcggcgagagcgtcgcgcccgagttcacatcggaagacggcgag
acggcgctcgcgcggtccgacaatgtcttttatctcgccggttggccggacgaagaattg
ctgacaagcgtcttgcggcgggttttcgttgtcgccggcatatcgacgctcgccttaccg
gaggacatccgcgtccgcgacaatggggcgatgcgctacatcttcaactacggcgccacg
acgacggatatttcggcgctcatcggcgacgaaactctatcgctgggcgagcgccttctc
gaaccctgcggcgtcgcggccttcaggcgtcgcggctga

DBGET integrated database retrieval system