KEGG   Methylocystis sp. SC2: BN69_1511Help
Entry
BN69_1511         CDS       T02324                                 

Definition
MCP methyltransferase/methylesterase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
msc  Methylocystis sp. SC2
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:msc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN69_1511
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BN69_1511
Enzymes [BR:msc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     BN69_1511
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BN69_1511
Two-component system [BR:msc02022]
 CheA family
  CheA-CheYBV
   BN69_1511
Bacterial motility proteins [BR:msc02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BN69_1511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1575999..1577951
Genome map
AA seq 650 aa AA seqDB search
MASDSRFPIVGVGASAGGLRALEQFFQAVPADLGMAFVIITHLAPDRESFLTDILARHTS
LNVHVAREGQKVEPNSIYVLPPNASLTIEGGTLRLHQIEPGHAERSPVDVFFSSLAQDCG
EYAVGVVLSGSGSDGVLGIKAIKEHGGLVLAQSSDGTKPSFTGMPDSAIASGLVDFAVPV
EDMAAKLSENRRSIGLVDALAERGAAQGDPPDAKSIEMLYAMLRSQLGHDFSGYKKRTFI
RRVHRRMQINHCDSLQSYVAFLQRDHDEPTRLFRDLLINVTSFFRDTEAFDALEKVVIPR
LFEGRGAADTLRIWVPGCSTGEEVYSIAILLREHMDKITGSPRVTVFATDIDEHALSVAR
AARYPSALMKGVSPERRERFFTNNSGSFVVVRSVRDLCVFSVHSILRDPPFSRIDMISCR
NLLIYFGANAQRQALPTLHYALRPGGFLFLGKAETIGRFSELFAPVNKTSCIFQARDIGA
PAHMPTFVNGLRPAPFVSPRSDHVAAGCMVARQSAEARIADRFGPPHVIVNEDGDIIHYS
ARTAKYLEAPYGAPTRQLLTLARKELRLDLRSALREAIETRRAATRDNIAFETDHHVEHV
SISVEPLTGGADGRATFLIAFEEKAPSKGVGRCERSASAARVRRRIADRN
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggattctcgattccccatcgttggcgttggcgcttccgccggtggactgcgg
gctctcgagcaattcttccaggccgtccccgccgatctcggcatggccttcgtgattatc
acgcacctcgccccagatcgcgaaagcttcctcacggacatactcgcgcgccacaccagc
ttgaacgtgcatgtcgcgcgcgaaggccagaaggtcgagccgaacagcatttatgttttg
ccgcccaacgcatctttgacgatagagggagggactctccgactccatcagatcgagccc
ggccatgccgaacgcagcccggtcgacgtgtttttcagttcgctcgcccaggattgcggg
gaatacgccgtcggcgtcgtgctctccgggagcggcagcgacggcgttctcggaatcaaa
gcgatcaaggaacacggcggccttgtccttgcacaatcgagcgacggcaccaagccaagt
ttcacgggcatgcccgacagcgcgatcgccagcggtctcgtcgactttgcggttcctgtc
gaggacatggccgcgaagctgtcagagaacaggcgaagcatcggattggtcgatgcgctt
gcggaaaggggcgccgctcagggcgaccctcccgacgccaagtcgatcgaaatgctctac
gccatgcttcgttcccaactggggcatgatttcagcggctacaaaaagcgcacatttatt
cgacgcgttcatcgccgcatgcagatcaatcattgcgattcgctgcagtcttacgtcgcg
ttcctgcaacgtgaccatgatgagccgacgcggctgtttcgcgatctcttgatcaatgtc
acgagtttcttccgtgacactgaggctttcgacgctttggagaaggtcgttattccgcgt
ctcttcgagggccgcggcgccgcagacacgctgcggatctgggtcccgggctgctcaacc
ggagaggaagtctattcgatcgcgatcctgcttcgcgagcatatggacaagataacaggg
tcgccgcgcgtcacggtctttgcgacggacatcgacgaacatgcgttatcggtggcgcgc
gccgcccgctatccgtccgcgctgatgaaaggcgtgtcgcccgagcggcgagagcgattc
tttacgaataattccggcagttttgtcgtcgtcagatcggtgcgcgatctttgcgtgttc
tcggtccacagcatcttgcgcgatccgccgttctcgcgcatcgacatgatctcctgccgc
aatctgttgatctacttcggcgccaatgcgcagcgccaggcgttgccgactctccattac
gcgctgcggccgggcggctttctctttcttggaaaagccgaaacgatcggccgcttttcg
gaattatttgcgccggtcaacaagacgagctgcattttccaggcgcgcgacatcggcgcc
ccggcccacatgccgaccttcgttaacggcctgcgcccggctcccttcgtctcgcctcgg
agcgatcatgtcgcggcaggatgcatggtcgcccgacagtcggcggaggcgcgaatcgcc
gaccgctttggaccgccgcatgtgatcgtcaatgaagatggcgacatcatccattattcc
gcgcgcacggcaaaatatctcgaagcgccctatggcgcgcccacgcggcaactgctgacc
ctggcgcgcaaggagctgcgtctcgatctacgcagcgcgctccgggaagcgatcgagacg
cgacgggccgcgacacgcgacaatatcgctttcgaaacagatcatcatgtcgaacatgtc
tcgatttcggtcgagcctctgacgggcggagccgatggccgagcgacgtttctcatcgcc
ttcgaagagaaagcaccttcaaaaggggttggtcgatgcgaacgaagcgcttcagccgca
agagtccgccggcgcatcgccgatcgaaattga

DBGET integrated database retrieval system