KEGG   Methylocystis sp. SC2: BN69_1880Help
Entry
BN69_1880         CDS       T02324                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
msc  Methylocystis sp. SC2
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN69_1880
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN69_1880
   00052 Galactose metabolism
    BN69_1880
   00500 Starch and sucrose metabolism
    BN69_1880
   00520 Amino sugar and nucleotide sugar metabolism
    BN69_1880
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BN69_1880
   00524 Butirosin and neomycin biosynthesis
    BN69_1880
Enzymes [BR:msc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BN69_1880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1935390..1936241
Genome map
AA seq 283 aa AA seqDB search
MYVVVDIGGTKTRVAGSSDLAELTEAVILKTPSDYRDALELLRAAALKAAAGDRIFAVVI
GVPGVLSRDKRILVNAPNLPIWNGATLAADVEASLGAPVLLENDTALVGLGEATAGAGQG
SAILAYVTISTGVNGARIVDGRIDRATYGFEIGEQYIDAGALNFEELVSGRAVANRFGAE
PCALGKDHPIWDELAKITARALHNAIAHWSPDRIVMGGSMMREIGISIEQTATYLRALPR
KTPALPDIVHATLGDYGGLWGALARLRQGGKGASCGAKGNSGG
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtatgttgtcgtcgacatcggcgggacgaagacgcgggtcgccggctcttccgatctt
gccgaacttaccgaggcggtgatcctcaagacgccgagcgattatcgtgacgcgctagag
cttttgcgcgctgcggccttgaaagcggcggccggcgaccgaatttttgctgtggtgatc
ggcgttcctggcgtgctgtcgcgcgacaagcgcatcctcgtcaatgcccccaacctgcca
atttggaatggcgcgacgttggccgccgacgttgaggccagtctcggcgcgcctgtctta
ctggagaacgacacggcgcttgtggggctaggggaagcgaccgccggcgctgggcaaggt
tccgccattctcgcatatgtcaccatctccactggcgtgaacggtgcgcgcatcgtcgac
gggagaattgaccgtgcgacctatggcttcgaaatcggcgagcaatatatcgacgccggc
gcgctcaatttcgaagagcttgtctcgggacgcgccgtcgcgaaccgctttggcgccgaa
ccctgcgcgctcggaaaggatcatccaatatgggatgaactcgccaagattactgcgcgc
gcgctgcacaacgccatcgcccattggtcgccagaccgaatcgtaatgggtgggtcgatg
atgcgcgagatcggcatctcaattgaacagacagcgacctatctacgggcgctgccgcga
aagacccccgcgcttcccgacatcgtccacgcgacgctcggcgactacggtgggttgtgg
ggcgcgctcgcgcgactccgtcaaggaggcaaaggcgcatcctgcggcgccaagggtaat
tccggcggttga

DBGET integrated database retrieval system