KEGG   Methylocystis sp. SC2: BN69_1900Help
Entry
BN69_1900         CDS       T02324                                 

Gene name
glpK
Definition
glycerol kinase (glycerol 3-phosphotransferase) (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
msc  Methylocystis sp. SC2
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BN69_1900 (glpK)
Enzymes [BR:msc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BN69_1900 (glpK)
Exosome [BR:msc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN69_1900 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1965060..1966556
Genome map
AA seq 498 aa AA seqDB search
MSKLLGALDQGTTSTRFIVMHSHGGIVAQAQREHRQIYPRPGWVEHDAAEIWRNAQAVIA
AALAEAKLSARDLSAVGVTNQRETTLLWDAATGAPLHHAIVWMDTRTQAAVDGIAAQGLG
DLVRAKTGLPLATYFSALKLGWLLEEIPGARERAAQGAALFGTIDSWIIWNLTGGPRGGR
HLIDATNASRTQLMNLETLQWDQELLRIFDVPAACLPKICSSSEVYGECVGALAGVPLAG
ALGDQHAALLGQACVNVGDAKNTYGTGCFLLMNVGETPRISTKGLLTTLAYQLGDAKPCY
ALEGSIAIAGALVQWLRDNLGIIKESREIEALASSVPDNGDVYFVPAFSGLFAPRWRGDA
RGIIAGLTRFSNKGHIARAALEAAAFQTREVLAAMIADAGVEISALKVDGGMAGSDLLMQ
FQADLIEAPVIRPRQLELTAVGAAYAAGLAVGVYKSLDDIAAHTRESRRFTPNMTPQERA
RLIASWEKAVERSLGWAL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaactcctgggcgcgctcgatcagggcacgacgagcacccgctttatcgtcatg
cacagtcacggtgggatcgtcgcccaggcgcagcgcgagcaccggcaaatctatccccgc
cccggctgggtcgagcatgacgccgccgaaatttggcgcaatgcgcaggcggtgatcgcg
gcggcgctggccgaggccaagctctccgcccgcgacctctcggccgtcggcgtcaccaat
cagcgcgagacgaccctcttgtgggacgccgcgaccggcgcgccgcttcatcacgcgatc
gtctggatggatacgcgcacgcaagccgccgtcgacgggatcgcggcgcaaggtttgggc
gatctggtccgcgcaaagacgggactgccgctcgcgacctatttttccgcgctcaagctc
ggctggcttcttgaagaaatccccggcgcgcgcgaaagggcggcgcagggcgcggcgctg
ttcggcacgatcgattcctggatcatttggaatctgaccggcggcccccgcggcggccgt
catctcattgacgcgaccaacgcctcgcgcacgcagttgatgaatctcgaaactctgcaa
tgggatcaagagctactgcggatcttcgacgttcccgcggcctgcctgccaaaaatatgc
tcgtcgagcgaggtctatggggaatgcgtcggcgcgctcgccggcgttccgctcgccggc
gcgctcggcgaccagcacgccgcgctgctcggccaagcctgcgtcaatgttggcgacgcc
aagaacacctatggcaccggctgctttttgctgatgaacgtcggcgagacgccgcgcata
tcgaccaagggcctgctgacgacgctcgcctatcagcttggagacgccaaaccctgttac
gcgctggaaggctcgatcgcgatcgccggcgctctggtgcagtggctacgcgacaatctc
gggatcatcaaagagagccgcgagatcgaggcgctggcgagtagcgtgcctgacaatggc
gacgtctatttcgtgccggccttctccggtctttttgcgccacgatggcgtggcgacgcc
cgcgggatcatcgccgggctgacgcggttctccaacaagggccatatcgcgcgcgcggcg
ctcgaagccgcggcgtttcagacccgggaagtcctggcggcgatgatcgccgacgcgggc
gtcgagatcagcgcgctcaaggtcgacggcggcatggctgggagcgatttgttgatgcag
tttcaggccgacctcatcgaggcgccggtcatccgcccccgccagctcgagttgacggcg
gtcggcgccgcctatgcagcgggacttgccgtcggcgtctacaaaagcctggatgacatc
gccgcgcatacgcgagaatcgcgtcgctttacgcccaatatgacgccgcaggagcgggcg
cgcctgatcgcatcctgggaaaaagccgtcgagcgttcgctcggctgggcgctctga

DBGET integrated database retrieval system