KEGG   Methylocystis sp. SC2: BN69_1939Help
Entry
BN69_1939         CDS       T02324                                 

Definition
glutathione S-transferase, N-terminal domain
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
msc  Methylocystis sp. SC2
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BN69_1939
Enzymes [BR:msc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BN69_1939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2004838..2005455)
Genome map
AA seq 205 aa AA seqDB search
MLTLYYHTGACSLAPHIALEWIGAPYETKAVEFGDKDYLKINPAGAVPALDTGEGWILTQ
AAAVLRYLAGRFPRSGIAPDGSPRDEAEADRWASFITGDLHPAFFPLFLPDRYTRAREKE
EFDNVREAAKALIRKKFGILDAHLSGRRYMVGDRRSYVDAYVFPMERWAAAMLEDGLSKY
PNVQKHHDMMAADEGVKRALAAEGA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgctcacgctctactatcacacaggcgcgtgttcgctcgcgccgcatatcgcgctcgaa
tggattggcgcgccctacgagaccaaggcggtcgagttcggcgacaaggactatttgaag
atcaatcccgcgggcgcagtgccggcgctcgacaccggcgaaggctggattctgacccag
gccgcggccgtgctgcgctatctcgccggccgcttcccgcgctcggggatcgcccccgac
ggttcgccgcgcgacgaggccgaggccgaccgctgggcatcctttatcaccggcgatctc
cacccggcctttttcccgctgttcctgcccgaccgctatacgcgcgcccgggagaaagaa
gagttcgacaatgtgcgcgaggccgccaaggcgctgatccgcaagaagttcggcattctc
gacgcgcatctgtcgggtcgccgctacatggtcggcgacaggcgcagctatgtcgacgcc
tacgtctttccgatggagcgctgggccgcggcgatgcttgaggacggtctgtccaaatac
cccaatgttcagaagcaccacgacatgatggcggcggacgagggggttaagcgcgcgctg
gcggcggaaggggcctga

DBGET integrated database retrieval system