KEGG   Methylocystis sp. SC2: BN69_1939Help
Entry
BN69_1939         CDS       T02324                                 

Definition
glutathione S-transferase, N-terminal domain
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
msc  Methylocystis sp. SC2
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:msc00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2004838..2005455)
Genome map
AA seq 205 aa AA seqDB search
MLTLYYHTGACSLAPHIALEWIGAPYETKAVEFGDKDYLKINPAGAVPALDTGEGWILTQ
AAAVLRYLAGRFPRSGIAPDGSPRDEAEADRWASFITGDLHPAFFPLFLPDRYTRAREKE
EFDNVREAAKALIRKKFGILDAHLSGRRYMVGDRRSYVDAYVFPMERWAAAMLEDGLSKY
PNVQKHHDMMAADEGVKRALAAEGA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgctcacgctctactatcacacaggcgcgtgttcgctcgcgccgcatatcgcgctcgaa
tggattggcgcgccctacgagaccaaggcggtcgagttcggcgacaaggactatttgaag
atcaatcccgcgggcgcagtgccggcgctcgacaccggcgaaggctggattctgacccag
gccgcggccgtgctgcgctatctcgccggccgcttcccgcgctcggggatcgcccccgac
ggttcgccgcgcgacgaggccgaggccgaccgctgggcatcctttatcaccggcgatctc
cacccggcctttttcccgctgttcctgcccgaccgctatacgcgcgcccgggagaaagaa
gagttcgacaatgtgcgcgaggccgccaaggcgctgatccgcaagaagttcggcattctc
gacgcgcatctgtcgggtcgccgctacatggtcggcgacaggcgcagctatgtcgacgcc
tacgtctttccgatggagcgctgggccgcggcgatgcttgaggacggtctgtccaaatac
cccaatgttcagaagcaccacgacatgatggcggcggacgagggggttaagcgcgcgctg
gcggcggaaggggcctga

DBGET integrated database retrieval system