KEGG   Methylocystis sp. SC2: BN69_1992Help
Entry
BN69_1992         CDS       T02324                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
msc  Methylocystis sp. SC2
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:msc01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:msc00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:msc00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2068692..2070005
Genome map
AA seq 437 aa AA seqDB search
MAEIRVPTLGESVTEATIGRWFKKAGDAVRADEALAELETDKVTLEVNAPAAGVLAEIVA
KEGETVGPGALLGQIAEGAAAPTKSGETAGKGPAPKPAPAPAAPAPAAPAPKAAAAPAAP
APPAATTMPPAPSAAKIAVEQGIDIAQVPGSGKRGQALKSDVVQFAARQAAAPQPAQEGR
VQELPAQEARVEAPAPRFPIPQEDARREERVKMTRLRQTIARRLKEAQNTAAILTTFNEV
DMSALIELRKRYKEAFEKRHGVKLGFMGFFVKACCQALEEIPAVNAEIDGTDIIYKRFCH
IGVAVGTEKGLVVPVVRDADRLSLAEIEKTIAELGRSAREGALDIADLQGGTFTISNGGV
YGSLMSTPILNAPQSGILGMHKIQERPVVVDGRIEARPMMYLALSYDHRVVDGKEAVTFL
VRVKELLEDPARLALGL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaatacgcgtgccgaccttgggcgaatcggtgactgaagcgacgatcggccgc
tggttcaagaaggcgggcgacgcggtgcgcgcggatgaggcgctcgccgagctcgagacc
gacaaagtcacgctcgaagtcaacgctcccgccgccggcgtgctcgccgagatcgtcgcc
aaggagggcgaaaccgttggccccggcgcgctgctcggtcagatcgccgagggcgccgcg
gcgccgacgaagagcggcgaaaccgccggcaagggcccggcgcccaaaccggcgccggcc
cccgcagcgcccgcccccgcagcgcctgcgcccaaagcggccgcggctccggccgcgccg
gccccgccggccgcgacgacgatgccgccggcgccctccgccgccaagatcgccgtcgaa
caggggatcgacatcgctcaggttcccgggagcggcaagcgcggtcaggcgctgaaatcg
gacgtcgttcaattcgccgcgcgtcaggcggccgccccgcagcccgcgcaagaaggccgc
gtccaggagcttccggcgcaggaggcgcgagtcgaggcgccggcgccccgcttccccatc
ccgcaggaagacgcccgccgcgaagagcgggtgaagatgacgcgcttgcgtcagacgatc
gcccgccggctgaaagaagcgcaaaacaccgccgccatactgacgacgttcaacgaagtc
gacatgtcggcgctcatcgaattacgcaaacgctacaaggaggcgttcgagaagcggcat
ggcgtcaagcttggcttcatgggcttcttcgtgaaggcctgttgccaggcgctggaggag
atccccgccgtcaatgcggagatcgacgggacggacatcatctacaagcgcttctgccac
atcggcgtcgccgtgggcacggagaagggactcgtcgtgccggtggtgcgcgacgccgac
cggctgtcgctcgccgagatcgaaaaaaccatcgccgaactcggccgcagcgcgcgcgag
ggcgcgctcgacatcgccgatctgcagggcggcaccttcacgatttccaacggcggcgtc
tatggttcgctgatgtccacgccgatcctgaacgcgccgcagtcgggcattctcggcatg
cacaagattcaggagcgccccgtggtcgtcgacggcaggatcgaagcgcggccgatgatg
tatctggcgctgtcttacgatcaccgtgtcgtcgacggaaaggaggccgtgactttcctg
gtgcgcgtcaaagagttgctcgaagatcctgcgcggctggcgctcggcttgtag

DBGET integrated database retrieval system