KEGG   Methylocystis sp. SC2: BN69_2128Help
Entry
BN69_2128         CDS       T02324                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
msc  Methylocystis sp. SC2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN69_2128 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN69_2128 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BN69_2128 (trpB)
Enzymes [BR:msc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BN69_2128 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2196576..2197814
Genome map
AA seq 412 aa AA seqDB search
MNKPLPNSFRAGPDENGRFGIFGGRFVAETLMPLVLDLEAAYENAKNDPAFHEELAGLHK
YYVGRPSPLYFAERITDYVRERAGEGKGAKVYFKRDELNHTGAHKINNVLGQILLARRMG
KKRIIAETGAGQHGVATATACARFGLDCVVYMGAVDVERQKPNVFRMKMLGAEVIPVQSG
ARTLKDAMNEALRDWVTNVADTFYCIGTAAGPHPYPAMVRDFQSIIGNETRVQMQEMEGR
LPDSLVACIGGGSNAIGLFHPFLDDASVEIYGVEAAGHGVDVPNGHAASLIGGRPGVLHG
NRTYLLMDDDGQILEGHSISAGLDYPGIGPEHSWLHEIGRVKYLNATDKEALNAFQLCSK
LEGIIPALEPSHALAKVFELAAQKPRDHLMVMNMCGRGDKDIFTVAEHLGGM
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaagccgctacccaattccttccgcgccggcccggatgaaaacggccgcttcggc
attttcggcgggcgtttcgtcgccgaaacgctgatgccgctcgtgctcgatctcgaagcg
gcctatgagaacgccaagaacgacccggcttttcacgaagagctcgccgggcttcacaaa
tattacgtcgggcgtccgtcgccgctctatttcgccgagcgcatcaccgactatgtgcgt
gagcgcgccggcgaaggcaaaggcgccaaggtctatttcaagcgcgacgagctcaaccac
accggcgcgcataagatcaacaatgtgctcgggcagattctgctcgcgcggcgcatgggc
aagaagcgcatcatcgccgagacaggcgccggccagcatggcgtcgccaccgccaccgcc
tgcgcgcgcttcggattggattgcgtcgtctatatgggcgcggtcgacgtcgagcggcag
aagcccaacgtcttccgcatgaagatgctcggcgccgaggtcattcccgtgcagtcgggc
gcgcgcacgctgaaagacgccatgaacgaagcgctgcgcgactgggtgaccaatgtcgcc
gacactttctattgcatcggcacggcggcggggccgcatccctatccggcgatggtgcgc
gacttccagtcgatcatcggtaatgagacgcgcgtgcagatgcaggagatggaggggcgc
ctccccgattcgctcgtcgcctgcatcggcggcggctccaacgccatcggcctgtttcat
ccgtttctcgacgacgccagcgtcgagatctacggcgtcgaagctgcgggccatggcgtc
gacgtgccgaacggccatgcggcctcgctcatcggcgggcgcccgggcgtgctgcacggc
aaccgcacctatctgttgatggatgacgatggccagattctcgaaggccattcgatttcg
gcgggcctcgattatcccggcatcggtcccgaacattcatggctgcatgagatcggccgc
gtgaaatatctgaacgccaccgacaaggaggcgctgaacgcttttcagctctgttcgaag
ctcgaggggatcatcccggcgcttgaaccttctcacgcgctggcgaaagtgttcgaactc
gcggcgcaaaagccgcgcgatcatctgatggtgatgaatatgtgcggccgcggcgacaag
gatattttcacggtcgccgagcatctcggcgggatgtga

DBGET integrated database retrieval system