KEGG   Methylocystis sp. SC2: BN69_2184Help
Entry
BN69_2184         CDS       T02324                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
msc  Methylocystis sp. SC2
Pathway
msc00230  Purine metabolism
msc01100  Metabolic pathways
Module
msc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BN69_2184
Enzymes [BR:msc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BN69_2184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_33 AAA_18 cobW AAA_22 TsaE RsgA_GTPase ABC_tran
Motif
Other DBs
NCBI-ProteinID: CCJ07635
UniProt: J7QU33
Position
complement(2249158..2249799)
Genome map
AA seq 213 aa AA seqDB search
MLPTPSSRRGIVLILSSPSGAGKTTLTRMLLQDRDLDLTLSISVTTRTRRSSEVDGIHYS
FIPERRFAAMRDAGELLEWAEVHGNFYGTPRGPVEDILAQGRDCLFDIDYQGTRQVREKM
GADAVTVFILPPSMDELRARLERRAEDSREAMARRLENARKEIARWKDYDYVIVNDDLQR
AFDDLIAILRAERQRRPRRDKEIEQFVAKLLNE
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgcttccgactccatccagccgccgcggcattgtcctcatcctttcctcgccctccggc
gcgggcaagacgacgctgacgcgaatgctgctgcaggaccgcgatctcgacttgacgctg
tcgatttcggtgacgacgcgcactagacgctcgagcgaagtcgacggcatccactacagc
ttcatccccgagcgccgattcgccgccatgcgcgacgccggcgaactcttggaatgggcc
gaggttcacggcaatttctacggcacgccgcgcgggccggtcgaagacattcttgcgcaa
ggccgcgactgcctcttcgacatcgactatcagggcacgcgccaggtgcgcgagaagatg
ggcgctgacgccgtcaccgtcttcatcttgccgccgtcgatggatgaattgcgcgcccga
cttgagcggcgcgcggaagattcgcgcgaggcgatggcgcgacggctggagaatgcgcga
aaggagatcgcgcgctggaaagattacgactatgtgatcgtcaatgacgatctgcagcgc
gccttcgacgatctgatcgcgatcctgcgcgccgaacggcagcgacggccaaggcgcgac
aaggaaatcgagcaattcgtcgccaagctgttaaacgaatag

DBGET integrated database retrieval system