KEGG   Methylocystis sp. SC2: BN69_2280Help
Entry
BN69_2280         CDS       T02324                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
msc  Methylocystis sp. SC2
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:msc00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2350690..2351277
Genome map
AA seq 195 aa AA seqDB search
MRVRWALEEVGQPYDVRLLSFEAMKDPAHLALHPFGQIPTYEEGDLALFESGAIVFHIAE
RHAGLLPDDANARARAITWMFAALSTMEPPIIDLAFARLLERGEAWYEQRLPVVEERVRH
RLGQLSLRLGDADWLDGPFSAGDLMMASVLLRLKASGLLDQYPNLSAYVARGEARPAYKR
AFEAQLAVFTAASRA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttcgctgggcgctcgaagaagtgggccaaccctacgacgttcggcttctttca
ttcgaagcgatgaaggatcccgcgcatctcgcgcttcatcccttcgggcagattccgacc
tatgaagaaggcgatctcgccctattcgagtcgggggcgatcgtgttccatattgcggaa
cgccatgccggcctgctgccagacgatgcaaatgcccgggcgcgcgcgatcacatggatg
tttgcggcgctcagcacgatggagccgccgatcattgatcttgcattcgccaggcttctg
gagcgcggcgaggcctggtacgagcagcgtctgcctgtcgtcgaggaacgcgtgcgtcac
cggctgggccaactttcccttcgccttggcgacgccgactggctcgatggtccgttcagc
gccggcgacctgatgatggcgtcggtgctgctcaggttgaaagcgtcgggtctattggac
caatatccgaacctctccgcctatgtcgcccgcggcgaagcgcggcccgcatataagcgc
gcgttcgaggcgcaactggcggttttcaccgccgcatcccgggcctag

DBGET integrated database retrieval system