KEGG   Methylocystis sp. SC2: BN69_2387Help
Entry
BN69_2387         CDS       T02324                                 

Definition
Asparagine synthase (Glutamine-hydrolyzing) (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
msc  Methylocystis sp. SC2
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN69_2387
Enzymes [BR:msc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BN69_2387
Peptidases [BR:msc01002]
 Cysteine Peptidases
  Family C44
   BN69_2387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2448056..2449057
Genome map
AA seq 333 aa AA seqDB search
MCGIVGAITREGSGPRDLTDALTLMFHRGPDGCGQWGEAYSERHAVAIGHRRLSIIDLSD
AASQPMVDVSGRYWLTFNGEIYNYIELRNELKAMGARFRTASDSEVILEAYKVWGTDCVT
RFNGMYGFAIWDTSARRLFAARDRFGEKPFLFVAKPELFAFASEYKALLTMPGVSRAHDD
FRLLRFATNPSTGLDGEGRQSSTIFISFCRAKRWRSVSTKTSRASGAITRRDSTPRALKS
PTRIFSPSFANSSLTASACGCAATSKSAPVSQAAWIRAPLSASPAAYSAMTPPTILSPAI
FRARTQTKLISPGSSSNRKVSKIISWSRLSTAS
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcattgtcggcgcgatcactcgtgaaggctcgggtccccgcgatctcacggac
gcccttaccctcatgttccatcggggacccgacggatgcgggcaatggggcgaagcctac
tccgagcgccacgccgtcgcgatcggccatcgccggctttccatcatcgacctgtccgac
gccgcaagccagcccatggtcgacgtcagtggacgctactggctaacgttcaacggcgag
atatacaattacatcgaattgcgcaacgaactgaaggcgatgggcgcgcggttccgaacc
gcgtcggacagcgaagttatcctcgaagcctacaaggtctggggaaccgactgcgtcacg
cggttcaacggcatgtatgggtttgcgatctgggacacatcggcgcgccgcctcttcgct
gcgcgggatcgctttggcgaaaagcccttcctgttcgtcgccaaacctgagctcttcgcc
ttcgcctccgaatataaggcgctgctgacgatgcccggcgtctcgcgcgcgcacgacgat
tttcgtcttctgcgattcgcgacgaatccgtcgaccggcctcgacggggaaggcagacag
tcttcgacgatattcatcagcttctgccgggcgaagcgctggagatcggtctcgacgaag
acaagccgcgcatctggcgctattacacgccgcgattcgacgccacgcgcgctcaaaagt
ccgacgcggatattttcgccgagtttcgcgaactcctctttgactgcgtccgcctgcgga
tgcgcagcgacgtcaaagtcggctcctgtctctcaggcggcctggattcgagcgccattg
tctgcatcgcccgccgcttactcggcgatgacgcctcctaccatactttcaccggccatt
ttccgggcacggacgcagacgaagctcatttcgccaggatcgtcgtcgaatcggaaggtg
tcgaaaatcatctcgtggagccgactgtcgaccgcttcatag

  All links  
No link information was found.   
DBGET integrated database retrieval system