KEGG   Methylocystis sp. SC2: BN69_2515Help
Entry
BN69_2515         CDS       T02324                                 

Gene name
folE1
Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
msc  Methylocystis sp. SC2
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BN69_2515 (folE1)
Enzymes [BR:msc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BN69_2515 (folE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2608259..2608831
Genome map
AA seq 190 aa AA seqDB search
MAKPTQADAEAAVRVLIEWAGDDPGREGLIDTPERVARSYRELFAGYEVDPRDYLKRTFD
EVGGYDELVVLKDIRVVSFCEHHMLPVTGRAHVGYLPNNRVVGISKLARVVHGFARRLQI
QEKLTAEIAEAIQDILEPQGVGVVIEAEHSCMTLRGVNTTGSLLTTSRLLGVIRDDPRTR
EEFLGMVHGK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcccactcaagctgatgcggaagcggccgtgcgggttctcatcgaatgggcg
ggagacgatcctggtcgcgaggggctgatcgacacgccggagcgggtggcgcgttcctac
cgcgagcttttcgccggctatgaagtcgacccgcgcgactatctgaagcgcaccttcgac
gaggtcggcggctatgacgaactcgtcgtcctcaaggacattcgcgtcgtcagcttctgc
gagcaccacatgctgccggtgaccgggcgcgcgcatgtcggctatctgccgaacaatcgg
gtggtcggcatctcaaagctcgcgcgggtcgtgcatggcttcgcgcgaaggttgcagatt
caggaaaagctcaccgccgaaatcgccgaagcgatccaggatattctggagccgcagggc
gtcggcgtcgtcatcgaggccgagcacagctgcatgacgctgcgcggcgtcaacacaacc
ggctcgctcttaacgacgagccgcctgctcggcgtcatccgcgacgacccccgcacccgc
gaggaattcctcggcatggtgcacgggaagtag

DBGET integrated database retrieval system