KEGG   Methylocystis sp. SC2: BN69_2777Help
Entry
BN69_2777         CDS       T02324                                 

Gene name
sucC2
Definition
(RefSeq) succinyl-CoA ligase (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
msc  Methylocystis sp. SC2
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN69_2777 (sucC2)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN69_2777 (sucC2)
   00640 Propanoate metabolism
    BN69_2777 (sucC2)
   00660 C5-Branched dibasic acid metabolism
    BN69_2777 (sucC2)
Enzymes [BR:msc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BN69_2777 (sucC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2858736..2859938
Genome map
AA seq 400 aa AA seqDB search
MNIHEYQAKAVLRAFGAPVADGVAVLRAEDARAAAEKLPGPVYVVKAQIHAGGRGKGKFK
EASAGDKGGVRIAKSIDEAEAFAKEMLGATLVTLQTGEAGKQVNRLYIEDGAAIDREFYL
SMLIDRSTSRIAYVVSTEGGMDIEKVAHDTPEKIVTFSVDPATGLMPHHGRQVAAALGLT
GDLAKQAGALTEKLYAAFVAKDMELLEINPLIVTKDGKLRCLDAKVSFENNALYRHPDMV
ELRDKSEEDEKEIEASKYDLAYISLPGNIGCMVNGAGLAMATMDIIKLYGEFPANFLDVG
GGATTEKVTAAFKIITADPNVKGILVNIFGGIMRCDTIAEGVIAAVKEVGLKVPLVVRLE
GTNVDLGKKIINESGLNVIPADDLDDAAQKIVAAIRAVAA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaataccaggccaaggccgttctgcgcgcgttcggcgcgcccgtcgcc
gacggcgtcgccgtgctgcgcgcagaggacgcccgcgcggcggccgaaaagctccccggc
ccggtctatgtggtgaaggcgcaaatccacgcgggcgggcgcggcaagggcaagttcaag
gaggcgtccgcgggcgacaaggggggcgtgcgcatcgccaaatcgatcgacgaggccgaa
gccttcgccaaggaaatgctcggcgcgacgctcgtcaccctccagaccggcgaggccggc
aagcaggtcaaccgcctctacatcgaggacggcgccgcgatcgacagggaattctacctc
tcgatgctgatcgaccgttcgacctcgcgcatcgcctatgtggtctcgaccgaaggcggc
atggacatcgagaaggtggcgcatgacacgcccgagaagatcgtgaccttttcggtcgat
ccggcgacggggctgatgccgcatcacggccgccaggtcgccgcggcgctcggcctcacc
ggcgatctcgccaaacaggcgggcgcgctgaccgaaaagctctacgccgcttttgtggcc
aaggacatggagcttctcgagatcaatccgctgatcgtcaccaaggacgggaagctgcgc
tgcctcgacgccaaggtcagttttgagaacaacgcgctctatcgccaccccgacatggtc
gagctgcgcgacaagagcgaagaggacgagaaggagatcgaggcgtcgaaatacgacctc
gcctatatctcgctccccggcaatatcggctgcatggtcaatggcgccggcctcgccatg
gcgacgatggacatcatcaagctctacggcgagtttccggcgaacttcctcgacgtcggc
ggcggcgccacgaccgagaaggtgacggccgcgttcaagatcatcaccgccgatccgaat
gtgaagggcatcctggtcaacatcttcggcggcatcatgcgctgcgacaccatcgccgaa
ggcgtgatcgcggccgtaaaggaggtggggctcaaggtgccgctcgtcgtgcggctcgag
ggcaccaacgtcgatctcggcaagaagatcatcaatgaatcgggcctcaacgtcattccc
gccgacgatctcgacgacgcggcgcagaagatcgtcgccgcgatccgagcggtcgcggcg
tag

DBGET integrated database retrieval system