KEGG   Methylocystis sp. SC2: BN69_2825Help
Entry
BN69_2825         CDS       T02324                                 

Gene name
folK
Definition
2-amino-4-hydroxy-hydroxymethyldihydopteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
msc  Methylocystis sp. SC2
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:msc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2898107..2898586
Genome map
AA seq 159 aa AA seqDB search
MRVGFGLGSNLGDKPANIREALRLIEACGLARLDRVSRIYRTPPWGDLDQGDFANACAIG
DTALAPYELLAAVKKIEADMGRAPTRRWGPRLIDVDILFLGDHAIDDPELTLPHKELFRR
GFVLAPLAEIAPELELDGISMRAALAGADASGVRPWSDE
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtcggatttgggcttggcagcaatcttggcgacaagccggccaatattcgcgag
gcgctgcggctgatcgaggcctgcgggctggcgcggctcgatcgggtctcccggatctat
cgcacgccgccctggggcgatctcgaccagggggatttcgccaacgcctgcgccattggc
gatacggcgctcgcgccctatgagctgctcgcggcggtcaagaagatcgaggccgacatg
ggccgggcgccgacgcggcgctgggggccgcggctgatcgacgtcgacattcttttcctc
ggcgaccatgcgatcgacgatccggagctgaccctgccgcacaaggagcttttccgccgc
ggcttcgttctcgcgccgctcgccgaaatcgcccctgagctcgaactcgacgggatcagc
atgcgcgcggcgctggccggcgctgacgcgagcggcgtgcgtccatggtcggacgaatag

DBGET integrated database retrieval system