KEGG   Methylocystis sp. SC2: BN69_3056Help
Entry
BN69_3056         CDS       T02324                                 

Definition
(RefSeq) Threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
msc  Methylocystis sp. SC2
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN69_3056
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN69_3056
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BN69_3056
Enzymes [BR:msc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BN69_3056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3139709..3141115
Genome map
AA seq 468 aa AA seqDB search
MRYLSTRGEAAQLGFDDVLLAGLATDGGLYTPLAYPRVAPSDIAALAGRPYAEATAQLIA
PYLSETFSREILRYQTVSAYSGFRHRAIAPLTQIADNLFVLELFHGPTLAFKDLAMQLLG
RMMNHVLEERNLRATIVGATSGDTGAAAIEAFKGLERVDVFILFPHGRVSDVQRKQMTTV
ADANVHTIALQGSFDDAQAILKRLFRAADFRARVGLAGVNSINWARVVAQTVYYFTSAVA
LGAPHRHISFAVPTGNFGDVLAGYVAKRMGLPIERLIVATNANDILARALASGRYEPRGV
TPTQSPSMDIQVSSNFERLLFDATGRDPAAVRAAFASLDQSGAFEIPAAALAAIRAEFDA
ESVGETETTAEIRRTWRETGYVLDPHTATGVSAARARLAKDPSTPVVALSTAHPAKFPDA
IERAIGLRPQPPENIAARLDAPERFTILENDGARVAEFISSHARAAKN
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
ttgcgctatctctcaacccgcggcgaggccgcgcagcttggcttcgacgacgttctcctc
gccggtcttgcgactgacggcgggctttatacgccgctcgcctatccgcgtgtggcgccg
tccgacatcgccgcgctcgcgggccggccctatgccgaagcgacggcgcagctgatcgcg
ccttatctcagcgagacgttttcgcgtgagattttgcgataccagacagtgagcgcctat
agcggatttcgtcaccgcgcgatcgcgccgctgacgcagatcgccgacaatctcttcgtg
ctcgaactgtttcacgggccgacgctcgccttcaaggatctggcgatgcagctcctcggg
cgcatgatgaatcatgtgctcgaagagcgaaatctgcgcgccaccatcgtcggcgcgacg
tccggcgacaccggcgccgcggcgatcgaggcgttcaagggattggagcgcgtcgacgtc
ttcatcctgttcccgcacggccgggtgtccgacgtgcagcgcaagcagatgaccacggtc
gccgacgccaatgttcacaccatcgcgctgcagggctcgtttgacgatgcgcaggcgatt
ctgaaacggctgtttcgcgccgccgactttcgggcgcgcgtcggactcgccggggtcaat
tcgatcaactgggcgcgcgtcgtcgcgcagaccgtctattatttcacgagcgcggtcgct
ctcggcgcgccgcatcggcatatttccttcgccgtgccgacgggcaatttcggcgacgtg
ctggccggctatgtcgccaagcgaatgggtctgccgatcgagagactgatcgtcgcgacc
aacgccaacgacatccttgcgcgcgcgctcgcaagcgggcgttatgagccgcgcggcgtc
acgccgactcagtcgccttcgatggatattcaggtttcatccaatttcgagcgcctattg
tttgatgcgacggggcgcgatccggcggcggtccgcgccgctttcgcctcgctcgatcaa
tccggcgccttcgagattccggctgcggcgctcgccgccattcgcgccgaattcgatgcc
gagtccgtcggcgagaccgagacgacggcggagattcgccgcacctggcgcgagaccggc
tatgtgctcgatccgcatacggcgaccggcgtcagcgcggcgcgcgcgcggctcgcgaag
gatccatcgacccctgtcgtcgcgctttcgaccgcgcatccggcgaagtttcccgacgcc
atcgagcgcgccatcggactgcgtccgcagccgcccgaaaatattgcggcgcggcttgac
gcgccggaacgattcacgattcttgaaaatgacggcgcgcgagtcgccgaattcatctcg
tcgcacgctcgggcggcgaagaactga

DBGET integrated database retrieval system