KEGG   Methylocystis sp. SC2: BN69_3218Help
Entry
BN69_3218         CDS       T02324                                 

Definition
(GenBank) Succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
msc  Methylocystis sp. SC2
Pathway
msc00020  Citrate cycle (TCA cycle)
msc00190  Oxidative phosphorylation
msc00650  Butanoate metabolism
msc01100  Metabolic pathways
msc01110  Biosynthesis of secondary metabolites
msc01120  Microbial metabolism in diverse environments
msc01130  Biosynthesis of antibiotics
msc01200  Carbon metabolism
Module
msc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
msc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
msc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN69_3218
   00650 Butanoate metabolism
    BN69_3218
  Energy metabolism
   00190 Oxidative phosphorylation
    BN69_3218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS SpoIID
Motif
Other DBs
NCBI-ProteinID: CCJ08669
UniProt: J7Q586
Position
3319549..3319944
Genome map
AA seq 131 aa AA seqDB search
MTVATRFKSGRTGPGDAYVSDHSGSPHARFMRLTSYALVPLGVLSAWWILGLAGKPLEGV
RAEIGRPIPALVLLAFGVIGMIHARRGMDDIIEDYVHDKALKAQAIVANTWASRAIAAIW
VVAILLIAAPK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgcgacaagattcaagagcggtcgaaccggacccggcgacgcctatgtctcc
gaccatagcggttccccccatgcgcgcttcatgcggctgacgtcttatgcgctggtcccg
cttggcgtgctgagcgcctggtggattctgggacttgccggcaagccgctcgaaggcgtg
cgcgccgaaatcggcagaccgattcccgcgctcgtgcttcttgcgtttggggtcatcggc
atgatccatgcgcggcgcggcatggacgacatcatcgaagattacgtgcacgacaaagcg
ttgaaggcgcaggcgatcgtcgccaacacttgggcgtcgcgggcgatcgcagcgatttgg
gtcgtcgcgatcctcctcatcgccgcgccgaagtag

DBGET integrated database retrieval system