KEGG   Methylocystis sp. SC2: BN69_3284Help
Entry
BN69_3284         CDS       T02324                                 

Definition
DNA polymerase III chi subunit HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
msc  Methylocystis sp. SC2
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BN69_3284
   00240 Pyrimidine metabolism
    BN69_3284
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BN69_3284
   03430 Mismatch repair
    BN69_3284
   03440 Homologous recombination
    BN69_3284
Enzymes [BR:msc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BN69_3284
DNA replication proteins [BR:msc03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BN69_3284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3384881..3385360
Genome map
AA seq 159 aa AA seqDB search
MPEIAFYHLTRATVEQTLPMLLERSRARGWRAIVQAMSEARLQRLDADLWSYRPESFLPH
GTKADGAAEAQPIYLTCGNDNPNDADVRFFVEGARIAPALAGSGAPRERAALVFDGRDDA
ELTDARAQWKELRDLGYSLVYHQQSESGGWEEKAREPKA
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagatcgccttctatcatctcacgcgcgccacggtggagcagacgttgccaatg
ctcctcgaacgttcgcgcgcgcgcggctggcgcgccatcgtgcaggcgatgagcgaagcg
cgcctccagcggcttgacgccgatctctggtcgtaccgtccggaaagctttctcccgcac
gggacgaaagccgacggcgcggcggaggcgcagccgatctatctcacctgcggtaacgac
aatcccaatgacgccgatgtgcggtttttcgtggagggcgcccgcatcgccccggcgctc
gccggctccggcgcgccgcgcgaacgcgccgcgctggtgttcgacgggcgcgacgacgcc
gaacttaccgacgcgcgcgcgcaatggaaagaactgcgcgatctgggctatagcctcgtc
tatcaccagcagagcgagagcggcggatgggaagagaaggcgcgcgaaccgaaagcatag

DBGET integrated database retrieval system