KEGG   Methylocystis sp. SC2: BN69_3453Help
Entry
BN69_3453         CDS       T02324                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
msc  Methylocystis sp. SC2
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:msc00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:msc00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3559469..3559993)
Genome map
AA seq 174 aa AA seqDB search
MQPKIVAVVARGRNGVIGVANGLPWRISSDLKRYKARTWGKPMIMGRRTFESIGRPLPGR
ESVVLTRDPHFRAEGAHVAANAPEALATARRLAGLLGVDEIIIAGGEDIYRAFLDLTDVI
ELTEVALDIAGDAHFPALDPKDWREIARETPPRGPKDEADFAFVTLERRRGQGA
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccaaaatcgtcgcggtcgtcgcgcgcggacgcaatggcgtgatcggcgtcgcc
aacggccttccctggcggatttcgagcgacctcaagcgctataaggcgcgcacctggggc
aagccgatgatcatgggacggcgcaccttcgaatcgatcgggcggccgctgcccgggcgg
gaaagcgtcgtgctgacgcgtgatccacatttcagggccgaaggcgcccatgtggcggca
aatgcccccgaagccttggcgacggcgcgacggctggccgggctgctcggcgtcgacgaa
atcatcatcgcaggcggcgaggacatctatcgcgcctttctcgatctcaccgacgtgatt
gaactcaccgaagtcgcgctcgatatcgccggcgacgcgcatttcccggcgctcgacccc
aaggactggcgcgagatcgcgcgcgaaacgccgccgcgggggccgaaagacgaagcggac
ttcgctttcgtcacgcttgaacggcgccgtggccaaggcgcctga

DBGET integrated database retrieval system