KEGG   Methylocystis sp. SC2: BN69_3458Help
Entry
BN69_3458         CDS       T02324                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
msc  Methylocystis sp. SC2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN69_3458
   00030 Pentose phosphate pathway
    BN69_3458
   00051 Fructose and mannose metabolism
    BN69_3458
   00052 Galactose metabolism
    BN69_3458
   00500 Starch and sucrose metabolism
    BN69_3458
   00520 Amino sugar and nucleotide sugar metabolism
    BN69_3458
  Nucleotide metabolism
   00230 Purine metabolism
    BN69_3458
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BN69_3458
Enzymes [BR:msc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BN69_3458
    5.4.2.8  phosphomannomutase
     BN69_3458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3567505..3569004
Genome map
AA seq 499 aa AA seqDB search
MFPKPVPNLRPNTFEYEQAPLIKSTGFREYDARWLFGADLNLMGVQALGMGLGALLRELG
VAPEIVVGHDYRSYSSSIKLALVSGLMAAGVRVRDIGLALSPMAYFAQFDLDVAAVAMVT
ASHNDNGWTGVKMGARRPVTFGPEEMGRLKEIVLAGEFHEAEGGSYRYIENFGARYIDDL
TRRPPFTRKMKVVAACGNGTAGAFAPQMLARLGCDVIPLDVTPDYTFPRYNPNPEDLHML
HAIADKVRETGACVGLGFDGDGDRCGVVDNHGEEIFADKIGVMLARDLSKVHPNASFVVD
VKSTGLFATDPELVARGVVTEYWKTGHSYIKRRVSEKKALAGFEKSGHFFFNEPIGRGYD
DGLLTAVHVLEMLDRNPTKSMAELYAELPKTWGSPTMSPHCDDEKKYGVIDKVTARIEAM
RAQGEQIIGQPIRDVVTINGVRVTVADGTWGLVRASSNKPELVVVVESPVSPSRMKEMFT
AIDAVLRENPEVGAYNQTI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtttcccaagcccgtcccgaatttgcgccccaacacattcgaatatgaacaagcgccg
ctcatcaaatcgaccggctttcgcgaatatgacgcgcgctggctgtttggcgccgacctc
aatttgatgggcgtgcaggcgctcggcatgggcctcggcgcgctgctgcgcgaattgggc
gtcgcgcccgagatcgtcgtcggccacgactatcgcagctattcttcttctatcaagctc
gcgcttgtaagcggcctgatggccgctggcgtgcgcgtgcgcgacatcggcctcgctttg
tcgccgatggcctatttcgcccagttcgatctcgatgtcgcggcggtcgcgatggtgacg
gcctcgcataacgacaatggttggacgggcgtgaaaatgggcgcgcgccgtccggtgacc
ttcgggccggaggagatgggccgtctgaaggagatcgttctcgccggcgaatttcacgag
gcggaaggcggctcttatcgttacatcgagaatttcggggcgcgctacattgacgatctc
acccgtcggccgccgttcacgcgcaagatgaaggtcgtcgccgcctgcggcaatggcacc
gccggcgccttcgcgccgcagatgctggcgcgcctcggctgcgacgtcattccgctagac
gtgacgccggactacactttcccgcgctacaatccgaaccctgaagatttgcatatgctg
cacgcgatcgccgacaaggtgcgcgagaccggcgcctgcgtcggccttggcttcgacggc
gacggcgatcgctgcggcgtcgttgacaatcatggcgaggagattttcgccgacaagatc
ggcgtcatgctggcgcgcgatctctcgaaggtccatccgaacgcgtcattcgtcgtcgac
gtgaaatcgacgggacttttcgcgacggacccggagctcgtcgcccgcggcgtcgtcacg
gaatattggaagaccggacattcttacatcaagcgccgcgtcagcgagaagaaggcgctc
gccggattcgaaaagtcggggcacttcttcttcaacgagccgatcggacgcggctatgac
gacgggctgctcaccgccgtgcatgtcctcgaaatgctcgatcgcaatccaacgaagtcg
atggccgaactctacgccgagctgccgaagacctggggctcgccgacgatgtcgccgcat
tgcgacgacgaaaagaaatatggcgtgatcgacaaggtgacggcgcgcatcgaggcgatg
cgcgcgcagggcgagcagatcatcggtcagccgatccgcgacgtcgtcaccatcaatggc
gtgcgggtgacggtcgccgacggcacctggggcctcgtgcgcgcatcgtcgaacaagccg
gaactcgtcgtcgtggtcgaaagtcccgtctcgccgtcgcgcatgaaggagatgtttacg
gcgatcgacgccgtgctgcgcgaaaatcccgaggtcggcgcttacaaccagacgatttag

DBGET integrated database retrieval system