KEGG   Methylocystis sp. SC2: BN69_3512Help
Entry
BN69_3512         CDS       T02324                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
msc  Methylocystis sp. SC2
Pathway
msc00010  Glycolysis / Gluconeogenesis
msc00051  Fructose and mannose metabolism
msc00562  Inositol phosphate metabolism
msc00710  Carbon fixation in photosynthetic organisms
msc01100  Metabolic pathways
msc01110  Biosynthesis of secondary metabolites
msc01120  Microbial metabolism in diverse environments
msc01130  Biosynthesis of antibiotics
msc01200  Carbon metabolism
msc01230  Biosynthesis of amino acids
Module
msc_M00002  Glycolysis, core module involving three-carbon compounds
msc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN69_3512 (tpiA)
   00051 Fructose and mannose metabolism
    BN69_3512 (tpiA)
   00562 Inositol phosphate metabolism
    BN69_3512 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BN69_3512 (tpiA)
Enzymes [BR:msc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BN69_3512 (tpiA)
Exosome [BR:msc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BN69_3512 (tpiA)
  Exosomal proteins of bladder cancer cells
   BN69_3512 (tpiA)
  Exosomal proteins of melanoma cells
   BN69_3512 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CCJ08963
UniProt: J7QTL4
Position
3623129..3623881
Genome map
AA seq 250 aa AA seqDB search
MTRRPLVAGNWKMNGLRASLAEIEAMGAAYDDALRARAELIVCPPATLIALAREIATRGG
LGLGGQNCHAEASGAHTGDISAEMLKDAGASFVIVGHSERRSDHGESDADVRAKAAAALR
AGLTPIICVGETRVEREAGEALSVVGAQIAGSLPADAPAHIVVAYEPVWAIGTGLTPTVD
DVAEMHAFARERIEARLGGGKSGDVRILYGGSVKPSNARELMHVANVDGALVGGASLTAK
EFIGVARAYV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtcgtccgctcgtcgccggaaattggaaaatgaacgggctgcgcgcctcgctg
gccgagatcgaggcgatgggcgccgcctatgacgacgcgctgcgcgcgcgcgccgaactg
atcgtctgtccgccggccacgctgatcgccctcgcgcgcgagattgcgacgcgcggcggc
ttgggccttggcgggcagaactgccatgccgaagccagcggcgctcacacgggcgatatt
tccgccgagatgctcaaggacgccggcgcgtcctttgtcatcgtcggccacagtgaacgt
cgttccgaccatggcgagagcgacgccgacgtgcgggcgaaggccgccgccgccctgcgc
gccggacttacgccgatcatttgcgtcggcgaaacgcgcgtcgagcgagaggcaggcgag
gcgttgagcgtcgtcggcgcgcagatcgcgggctcgcttcccgccgatgcgcctgcgcat
atcgtcgtcgcctatgagccggtctgggcgatcggcacaggcttgacgccaaccgtcgat
gacgtcgccgaaatgcatgccttcgcgcgcgagcggatcgaagctcggctcggcggcggc
aagagcggcgacgtgcgcattctctacggcggctcggtcaagccgtcgaacgcccgcgaa
ttgatgcatgtcgccaatgtcgacggcgcgctggttggcggcgcgagtttgacggccaag
gagttcatcggcgtcgcgcgcgcctatgtctga

DBGET integrated database retrieval system