KEGG   Methylocystis sp. SC2: BN69_3530Help
Entry
BN69_3530         CDS       T02324                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
msc  Methylocystis sp. SC2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3643985..3645133)
Genome map
AA seq 382 aa AA seqDB search
MACVPKFRKSVETTLVSLPLVALLAAGGWAMAEPLGLPKVPVPADNPQSPEKVALGDKLF
HDARFSIDGTVSCSTCHNDKKAFTDSPLRVSEGHNKLTGTRNAPSVINAAFYTSQFWDGR
SISLEDQSQHPMVNPVEMGLPDHEPVLKIVREDPAYIEGFKKAFGKSGRDVTMDDVKKAI
ASFERTVISGDSPFDKWYFGGDRNAISDQAKRGFDLYVGQGRCVSCHAIEQTQALFTDNR
FHNIGVGINRIQADVPRLAAEFLKAKAAGASVDKTVLADPKVSELGRFAVTNSFDEIGAF
KTTTLRNIAMTAPYMHDGSLKTLKDVVKHYNEGGKSPGDPTPVNPYLSGGIRPLDLKDQQ
IDDLVAFLETLTSPAFVTAQTK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgcgttcctaagtttcgcaaatccgttgagacgacgcttgtttcgcttccgctt
gtggcgctgctcgccgccggcggctgggcgatggccgagccgctcggcctgccgaaagtc
ccggttccggccgacaatccgcagtctccggaaaaggtcgcgctcggcgacaagctgttc
catgacgcgcgcttctcgatcgacggcacggtgagctgctcgacctgtcataacgacaaa
aaagctttcacggacagtccgttgcgggtttccgagggccacaacaaattgaccggcacg
cgcaacgccccgtcggtcatcaacgcggcgttttacacgtcgcagttctgggacggccgc
tcgatctcgctggaggatcagtcgcagcacccgatggtcaatccggtggaaatggggctg
cccgatcacgagccggtgctcaagatcgttcgcgaagatcccgcttatatcgagggtttc
aagaaggcgttcggcaagagcggccgagacgtgacgatggatgacgtcaaaaaggcgatc
gcgagcttcgagcgcacggtcatctcgggcgattcgcccttcgacaaatggtatttcggc
ggcgaccgcaacgccattagcgatcaggccaagcgcggcttcgacctttatgtcggtcag
ggacgctgcgtgtcctgccacgccatcgaacagacgcaggcgctcttcaccgacaaccgg
ttccacaatatcggcgtcggcatcaaccgcattcaagccgacgtgccgcgcctcgccgcc
gaattcctcaaggcgaaagccgcgggcgcctccgtcgacaagaccgtgctcgccgatccg
aaggtctccgaactcggccggtttgcggtgacgaattccttcgacgaaatcggcgccttc
aagaccacgacgctgcgcaatatcgcgatgaccgcgccttatatgcatgacggctcgctc
aagacgctcaaggacgtggtcaaacattacaatgagggcggcaagagtcccggcgacccg
acgccggtcaatccctatctctcgggcggcatccggccgctggatctgaaggatcagcag
atcgacgatctcgtcgccttccttgagacgctgacgagccccgcttttgtgacggcgcag
acgaaataa

DBGET integrated database retrieval system