KEGG   Methylocystis sp. SC2: BN69_3575Help
Entry
BN69_3575         CDS       T02324                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
msc  Methylocystis sp. SC2
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:msc00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3683764..3684711)
Genome map
AA seq 315 aa AA seqDB search
MRELVASPGNPIPEGAAVYTLKTRDGRRLRAAAFPCSERARGTVALFQGHNEFIEKYFET
IEDLRSRRLDVVALDWRGQAGSERELADPRKGHIDDFSQYQRDLEVFISQVLSDRPKPWF
ALAHSMGAAILLDAAHAGKTPFQRFVLTAPMIDLANLRFPRASRWLADTLDMCGLGGMYI
PGGTGASFIEKPFERNLLTTDRVRFERNAAILREAPQLAIGDPTIGWVNAAFRLMRGFES
PDYARSIRATILMFGCGREMIVSNGAIERFAQNLDSGVLAMVPGAKHELMMERDEFRSQF
WRGFDAFIPGEARVS
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaacttgtcgcgtcgcccggcaacccgatccccgagggcgccgccgtttacacc
ctgaagacgcgggacggccggcgattgcgcgccgccgcttttccctgcagcgagagagcg
cgcggcacggtggcgctgtttcagggccacaatgaatttatcgaaaaatatttcgagacc
atcgaggatttgcgcagccgccgcctcgacgtggtggcgctcgattggcgcggccaagcc
ggctcggagcgcgagctcgccgacccgcgtaagggccacatcgacgatttctcgcaatat
caacgcgatctggaggttttcatctcccaggtgttgagcgaccggccgaagccctggttc
gcgctcgcccattccatgggcgcggccatcctgctggacgcggcgcatgcaggaaaaacg
ccgttccagcgcttcgtgctgaccgcccccatgatcgacctcgccaatctgcggtttccg
cgcgcctcgcgctggctcgccgacacgctcgacatgtgcggactgggcggcatgtacatt
ccgggcggaaccggcgcctcctttatcgagaagcccttcgaacgcaatctgctgaccacc
gatcgcgtccgcttcgaacgaaacgccgccattctcagggaggcgccgcagctcgccatc
ggcgatccgacgatcggctgggtcaacgccgccttccgtctcatgaggggcttcgaatcg
cccgactacgcccgaagcatccgcgcgaccatcctgatgttcggctgcggtcgcgagatg
atcgtctctaacggcgccatcgagcgttttgctcaaaatctcgacagcggcgttctcgcg
atggtccccggcgccaagcatgaactgatgatggagcgcgacgagtttcgcagtcagttc
tggcgcggcttcgacgctttcatcccgggcgaggcgcgcgtttcctag

DBGET integrated database retrieval system