KEGG   Methylocystis sp. SC2: BN69_3616Help
Entry
BN69_3616         CDS       T02324                                 

Definition
Class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
msc  Methylocystis sp. SC2
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BN69_3616
Enzymes [BR:msc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BN69_3616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3725476..3726129
Genome map
AA seq 217 aa AA seqDB search
MNERDARAAIVDAAQEMERLGLNHGSAGNLSLRVGDAALVTPSGVPARELAPELIARMPL
AGDGDFEGPLPPSSEWRFHLDVYRARPDVNAIAHMHSPYATTIATLRRDIPAVHYMIAAF
GGPTVRCVDYAPYGTAELSRLVVAGLKDRDGVLLANHGAIVTGATMRRALWRAVELEALA
QVFYLGALAGEPVVLSDEEIMRTVERFKTYGTRDAKN
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagcgcgacgcgcgcgcggcgatcgtcgacgccgcgcaggagatggagcggctg
ggcctcaatcacggctcggccggcaatctgtcgttgcgggtcggcgacgccgcgctcgtc
acgccgagcggcgttccagcccgcgaacttgcgcccgaactgatcgcgcgcatgccgctg
gcgggggatggcgacttcgagggtccgctgccgccgtcgagcgagtggcgcttccatctc
gacgtctaccgcgcccggcccgacgtgaacgccatcgcgcatatgcattcgccctatgcg
acgacgatcgcgacgctgcggcgcgacattccggcggtgcattacatgatcgcggccttc
ggcggcccgaccgtgcgctgcgtcgactatgcgccctacggcacggcggaactgtcgcga
ctcgtcgtcgccgggctcaaggatcgcgacggcgtgctgcttgccaatcatggcgcgatc
gtcaccggcgcgacgatgcgcagagcattgtggcgcgccgtcgaactcgaagcgctggcg
caagtcttctatctcggcgcgctcgccggcgaacccgtcgttctctccgatgaggagatc
atgcgcacggtggagcgcttcaagacgtacggaacgcgcgacgcaaagaattga

DBGET integrated database retrieval system