KEGG   Methylocystis sp. SC2: BN69_3665Help
Entry
BN69_3665         CDS       T02324                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
msc  Methylocystis sp. SC2
Pathway
msc00071  Fatty acid degradation
msc00280  Valine, leucine and isoleucine degradation
msc00281  Geraniol degradation
msc00310  Lysine degradation
msc00360  Phenylalanine metabolism
msc00362  Benzoate degradation
msc00380  Tryptophan metabolism
msc00410  beta-Alanine metabolism
msc00627  Aminobenzoate degradation
msc00640  Propanoate metabolism
msc00650  Butanoate metabolism
msc00903  Limonene and pinene degradation
msc00930  Caprolactam degradation
msc01100  Metabolic pathways
msc01110  Biosynthesis of secondary metabolites
msc01120  Microbial metabolism in diverse environments
msc01130  Biosynthesis of antibiotics
msc01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:msc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN69_3665
   00650 Butanoate metabolism
    BN69_3665
  Lipid metabolism
   00071 Fatty acid degradation
    BN69_3665
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN69_3665
   00310 Lysine degradation
    BN69_3665
   00360 Phenylalanine metabolism
    BN69_3665
   00380 Tryptophan metabolism
    BN69_3665
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN69_3665
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN69_3665
   00281 Geraniol degradation
    BN69_3665
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN69_3665
   00627 Aminobenzoate degradation
    BN69_3665
   00930 Caprolactam degradation
    BN69_3665
Enzymes [BR:msc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN69_3665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: CCJ09116
UniProt: J7QJM5
Position
3772083..3772904
Genome map
AA seq 273 aa AA seqDB search
MKRATRRSRRMGEEARMTYDTIAVETQGRVGLIRLNRPEALNALNARLIAELDDALAKFE
FDDGVGCVVLTGSEKAFAAGADIKEMRDKGFVDAFLDDFIGRWDVVARARKPIIAAVSGF
ALGGGCEIAMMCDFILAADTAVFGQPEIKLGVIPGAGGTQRLTRAVGKAKAMDLILTGRM
MGAEEAERAGLVARIVPAADLLAEATKTAATIASMSLPAVLMAKEAVNRAFESTLAEGIR
HERGLFYSLFATGDQKEGMNAFVEKRKPAFANR
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcgcgacccggcgaagtcgccggatgggcgaggaggcgcgcatgacttatgac
acgattgcagtcgaaacgcagggccgagtcggactgatccgtctcaaccggcccgaggcg
ctcaacgcgctgaacgcgcggctcatcgccgagctcgacgacgcgctcgcgaaatttgaa
ttcgacgacggcgtcggctgcgtcgtcctcaccggctccgagaaggccttcgccgctggc
gcggacatcaaggagatgcgcgacaagggcttcgtcgacgcctttctcgacgatttcatc
ggccggtgggacgtcgtggcgcgggcccgcaagcccatcatcgccgccgtctccggcttc
gcgctgggcggcggctgcgaaatcgcgatgatgtgcgacttcattctcgcggcggacacg
gcggtcttcggccagccggaaatcaagctcggcgtgattcccggcgccgggggcacgcag
cggttgacccgcgccgtcggcaaggccaaggcgatggatcttatactgacggggcggatg
atgggcgccgaggaggccgagcgcgccggcctcgtcgcgcggattgtcccggccgccgat
ctgctcgccgaggcgaccaagacggcggcgacgatcgcgtccatgtcgcttcctgcggtt
ctcatggccaaggaggcggtcaatcgcgcttttgaatcgacgctcgccgagggaatccga
catgagcgagggcttttctattcgcttttcgccacgggcgatcaaaaggaaggcatgaac
gccttcgtggaaaagcggaagccggccttcgccaatcgatag

DBGET integrated database retrieval system