KEGG   Myxococcus stipitatus: MYSTI_00297Help
Entry
MYSTI_00297       CDS       T02436                                 

Definition
putative asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
msd  Myxococcus stipitatus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:msd00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(377559..378875)
Genome map
AA seq 438 aa AA seqDB search
MWRLLPPPLRGRATLPEEKPRAEPSEARGGSTPLLGLEPACIAAFLLHALPPSQSLFRGV
SRVAPPLPQVQREAAPAQSLSNEAEVQVHDEQARRLVSACSDVVGARVAAGARDVSLSGG
VDSAVLCALAARHAPGRVRAWSMEVHFADETERRNARTVARLTGVELVDVPIPDAVLPDL
FEPTVIATETPLLNARVIASFAFYAAARLLGASVMLSGAGADEVLRGNPDAMASAATRID
EDRKLARTVLRPLVDNLGDPRDPMPWSLADRESSEEVRHAAWVLRELVLPPELRGARTHR
LTVHTPYLDTRFANVALSLPESSLSREGVGKWLFRQGVRGLVPDEVRLARKTPRYGHTAL
SSPMRARWLELYRAWLSPSRLEPLEVIDPEAALALLEYSTHIEPDAPEASAVDRLLMRLC
SLAMLHAHAARGSSCPES
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtgtggcggttgctcccgcccccgctccgaggcagggccacgctgcccgaggagaagccc
cgcgccgagccctccgaggcccgcggcgggagcacgcccctcctggggctggagcccgcg
tgcatcgccgcgttcctgctccatgccctgccgccgagccagagcctgttccggggcgtg
agccgcgtggcgccacccctgccccaggtccagcgcgaagccgcgccggcgcaatccctc
tccaacgaggccgaggtccaggtccacgacgagcaggcacggcgactcgtgtccgcgtgc
tccgacgtggtgggcgcacgtgtcgccgcgggcgcgcgggacgtgagcctgagcggcggc
gtggacagcgcggtgctgtgcgcgctggcggcccgtcacgcgcccggccgggtccgcgcc
tggagcatggaggtccacttcgccgatgagacggagcggcgcaacgccaggaccgtcgcg
cgcctcaccggcgtggagctggtggacgtgcccatcccggacgccgtgctgcccgacctg
ttcgagcccaccgtcatcgccaccgagacgcccctcctcaacgcgcgggtcatcgcgagc
ttcgccttctacgcggcggcccggctgctgggcgcgtcggtgatgctcagcggggcagga
gcggacgaggtgctccgagggaacccggacgcgatggcctcggcggcgacgcgcatcgac
gaggaccggaagctcgcgcgcacggtgctgcgcccccttgtggacaacttgggggaccca
cgcgacccgatgccctggtcgcttgcggaccgggagtcctccgaagaggtgcgccatgcc
gcctgggtgctgcgcgagctggtgttgcctccggagctgcgcggcgcgcggacccaccgg
ctcaccgtccacacgccctacctcgacacgcgcttcgcgaacgtggcgctctcgctgccg
gagtcctccctctcgcgcgaaggcgtcggcaagtggctgttccgccagggcgtgcgcggc
ctcgtcccagatgaagtgcggctcgcgcgcaagacgccacgctacgggcacacggcgctc
tccagtcccatgcgggcccgctggctggagctctaccgcgcctggctgtcgccctcgcgc
ctggagccgctggaggtcatcgacccggaggccgcgctggcgctgctggagtattccacg
cacatcgagcccgacgcccccgaggccagcgcggtggatcgcctgttgatgcggttgtgt
tccctcgccatgctccacgcgcacgcggcgcgaggctcctcatgtcccgaatcctga

DBGET integrated database retrieval system