KEGG   Myxococcus stipitatus: MYSTI_00474Help
Entry
MYSTI_00474       CDS       T02436                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
msd  Myxococcus stipitatus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MYSTI_00474
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYSTI_00474
  Lipid metabolism
   00071 Fatty acid degradation
    MYSTI_00474
  Amino acid metabolism
   00350 Tyrosine metabolism
    MYSTI_00474
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MYSTI_00474
   00626 Naphthalene degradation
    MYSTI_00474
Enzymes [BR:msd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MYSTI_00474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
569256..570257
Genome map
AA seq 333 aa AA seqDB search
MDGTMRVMVLHAPGQPLREERWPVPRPGPQEVLLQVRACAVCRTDLHLVDGELPRPKLPV
VPGHEVVATVVEAGAEVLGLEVGTRVGVPWLGWTCGQCRYCVSGRENLCDDARFTGYQVD
GGYAEYTVAHHRYCFPLPASYPDFHAAPLMCAGLIGFRSLRMAGDGERLGMYGFGAAAHV
LIQVARYQGRRVFAFTRPGDEAGQHFARESGAEWAGGSDVLPPEPLDAAILFAPVGALVP
AALRAVDKGGVVVCGGIHMSDVPSFPYALLWEERGVRSVANLTRADALDFLVLAPLVPVR
TEVRVFPLSAANEALAALREGQVRGAAVLDPRA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggacggcaccatgcgtgtgatggttctccacgcacccgggcaaccgcttcgagaggag
cggtggcccgttcctcgtccggggccgcaagaggtgctgctgcaagtgcgggcgtgcgcg
gtgtgccgcacggacctgcacctggtggatggagagctgccccggcccaagctgcccgtg
gtgccgggccatgaagtggtggccaccgtcgtcgaggcgggcgccgaggtgctggggctg
gaggtgggcacccgcgtgggcgtgccctggctcgggtggacgtgcggccagtgccgctac
tgcgtctccggtcgggagaacctctgcgacgatgctcgcttcaccggttaccaggtggat
ggcggttacgccgagtacaccgtggcgcaccaccgctactgctttccgctgccggcgagc
tacccggacttccacgccgcgccgttgatgtgcgcggggctcatcggctttcgcagcctg
cgcatggcgggagacggtgagcggctggggatgtatggctttggcgccgccgcgcacgtg
ctcatccaggtggcgcgctatcaaggtcggcgcgtgtttgccttcacgcggccgggggac
gaggcggggcagcacttcgcgcgggagtcgggcgcggagtgggcggggggctcggatgtc
ttgccgcccgagcccttggacgcggccatcctcttcgcgcccgtgggggcgctggtgccc
gcggcgctgcgggccgtggacaagggcggtgtcgtggtgtgtggcggcatccacatgagc
gatgtcccgtcgttcccgtatgcgctgctctgggaggagcgcggggtgcgctcggtggcg
aacctgacgcgggcggatgcgctggacttcctggtgctcgcgcccttggtgcccgtgcgc
accgaggtgagggtgttcccgctctccgccgcgaacgaggcgctcgccgcgctgcgcgag
ggacaggtgcgcggcgcggccgtgctggaccctcgcgcgtag

DBGET integrated database retrieval system