KEGG   Myxococcus stipitatus: MYSTI_00872Help
Entry
MYSTI_00872       CDS       T02436                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
msd  Myxococcus stipitatus
Brite
Enzymes [BR:msd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     MYSTI_00872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1078820..1079437)
Genome map
AA seq 205 aa AA seqDB search
MIDLYTFATPNGRKVSIALEELGLPYTAKSVDITKGDQFKPEFLAINPNNKIPAIVDSEG
PDGRPLTVFESGAILLYLAEKTGKLMPSSLRGKTEVTQWLMFQMGGVGPMFGQFNHFHRF
LSTKIPYAVDRYTQESKRLIGVLDGQLAKGDYVAGAYSIADIALYPWVRGVRDYAPDLFH
GTRGVPQWLERVGSRPAVQRGMKVP
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgattgacctgtacacgttcgccacgcccaacgggcgcaaggtctccatcgccctggag
gaactggggctgccctacaccgcgaagtcggtggacatcacgaagggcgaccagttcaag
cccgagttcctggccatcaaccccaacaacaagattccggccatcgtcgactcggagggc
ccggacggccgccccctcaccgtcttcgagtcgggcgccatcctgctgtacctcgcggag
aagacgggcaagctgatgccctccagcctgcgcggcaagacggaggtgacgcagtggctg
atgttccagatgggcggcgtggggcccatgttcggccagttcaaccacttccaccgcttc
ctctcgacgaagattccctacgcggtggaccgctacacgcaggagtcgaagcggctcatc
ggcgtgctggacggacagctcgcgaagggtgactacgtcgcgggcgcgtactccatcgcg
gacatcgccctgtacccctgggtccgcggcgtgcgcgactacgccccggacctcttccac
gggacgcgcggcgtgccacagtggctggagcgagtgggcagccgtcccgccgtgcagcgt
ggcatgaaggtgccctga

DBGET integrated database retrieval system