KEGG   Myxococcus stipitatus: MYSTI_01377Help
Entry
MYSTI_01377       CDS       T02436                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
msd  Myxococcus stipitatus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MYSTI_01377
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MYSTI_01377
Enzymes [BR:msd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MYSTI_01377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1719428..1720555
Genome map
AA seq 375 aa AA seqDB search
MSHSGRNALRAAKRVVVKIGTNALTHATGRFNREHFEALGRDLLWAAQGRELVVVSSGAI
ALGVERLGLAARPRDIPGKQACAAVGQSRLMQAYEDVFGGQGQAVAQVLLTHEDMRDRRR
YLNVKHTLERLLSARVVPVINENDTVSVDELKFGDNDTLAGLVAGVVEADALVLLSDVDG
LHTADPRRDASAKLLETVEEVTPEVLSLAGGTSSGVGTGGMATKVRAASSAAEQGIRSVI
TSGAEPGRLRAVLGGEQVGTLFEPTGARRGSRAAWIAHALRPQGTLRVDAGARDAIVQGK
RSLLPSGVRSVEGDFDRGDPVDLADESGEVFARGLASYDAQELRRIAGRRTSDIESVLGY
RYLDEAVHRDDLAVL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcactcgggacgtaacgccctgcgcgccgcgaagcgcgtggtcgtgaagatcggc
accaacgccctcacccatgccaccggtcgcttcaatcgcgagcacttcgaggcgctgggc
agggacctgctctgggcggcccagggccgcgagctcgtggtggtctccagcggcgccatc
gccctgggcgtggagcggctgggcctggctgctcgccctcgggacatcccgggcaagcag
gcctgcgccgcggtgggacagagccggctgatgcaagcctacgaggacgtcttcggaggg
caggggcaggccgtcgcccaggtgctcctcacccacgaggacatgcgcgaccggcggcgc
tacctcaacgtgaagcacacgctggagcggctgctgtccgctcgcgtggtgccggtcatc
aacgagaacgacaccgtctccgtggatgagctgaagttcggcgacaacgacacgctggcg
ggactggtggcgggggtcgtggaggcggacgcgctggtcctcctctccgacgtggatggg
ttgcacaccgcggaccctcgccgcgatgcgagcgcgaagttgttggagacggtggaggag
gtgacgccggaggtgctctcgctcgcgggaggcacgtccagtggcgtgggcaccggcggc
atggcgaccaaggtgcgcgccgcctccagcgccgcggagcagggcatccgaagtgtcatc
acctccggcgccgagcccggtcggctgcgcgccgtgctgggaggcgagcaggtggggaca
ctcttcgagcccacgggcgcgcgccgaggctcccgcgccgcgtggattgcccatgccctc
cggccgcagggcacgctccgagtggatgcgggggctcgcgacgccatcgtccagggcaag
cgcagcctgcttcccagcggtgtgcggagcgtggagggggactttgatcgcggcgacccg
gtggatctggcggacgagtccggcgaggtgttcgcgcgagggctcgcgtcgtacgacgcc
caggaactccggcgcatcgcggggcgacgcacctccgacatcgagtcggtcctgggctac
cgctacctggacgaagccgtgcaccgcgacgacctggcggtgctctag

DBGET integrated database retrieval system