KEGG   Myxococcus stipitatus: MYSTI_01407Help
Entry
MYSTI_01407       CDS       T02436                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
msd  Myxococcus stipitatus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:msd00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:msd00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:msd02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1756128..1758281
Genome map
AA seq 717 aa AA seqDB search
MFDRLNRRSFLQAVVAVAASTSFGCSEEESSQDGSKYFPQSICSGDPRPDSVVLWVRAVD
PENAGADTAVRLEVSTNKEFSSLVLDKRFSALASNDHALKVKVTNLKARTTYYYRFTFEK
GGETYVTATGRTRTAPAAGDDVAVKFAFASCQDYIGRYYNTWLKLLKLDEDLDFVVFLGD
YIYETTGDTSFQTPTSTRSITFSEPEAALKHGTGSVAFYAANSLSNYRDIYKAIRSDKVI
QQVHERYPFIVMWDDHEFSDDNWGPNATYTDGVKKEEQVDRKKNSERAFFEYIPLDNTQA
AEGAIDVASAPVYPNTLIYRDFEFGKNLKMAVSDFRTFRPDHLIPEDAYPGQVAVTAEVL
GQFLPGLPAPVQGLLQTETFAYVNIDAPEFAAQKAALMGAFVAEATKSGLTQGEATERAQ
ASVKGSLALFYVNQVLKKVNEARAAAGAPAIPAIAATGAPRGLSYAHMGKAGLFGIQGTR
YIVVKPIFDLFAFIRYTLTRGASEDALGQAQQTWLQNQLKATNTWKIIVSSVSMTSMVFD
LSQKMDIPDPTLRQTFYFNVDQWDGFPTKKQELLKYIRDNQVQNALFVSGDIHASFASVE
SGVPSLTAPAISSGSIKELAGMAVIGAGYLQGSAVHRYVVAELNESLAAGNPGMRYVNGD
AHGFVILELKGNEALAAYHLIPSTEVTKDYSLKTDAELDARFTRVDFRVTNGTITKL
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgacagattgaatcgtcgcagcttcttgcaggccgtggtcgccgtcgcggcaagc
acctcgtttggatgttccgaggaggagtcgtcacaagacggttcgaagtacttcccgcag
tccatctgttccggagacccgaggccggacagcgtggtgctgtgggtgcgcgcggtggac
ccggagaacgcgggcgcggacacggcggtgcggctggaggtgtccacgaacaaggagttc
agcagcctggtgctggacaagcgcttctcggcgctggcctcgaatgaccatgcgctgaag
gtgaaggtcacgaacctgaaggcgcgcacgacgtactactaccgcttcaccttcgagaag
ggcggcgagacgtacgtgacggcgacgggccgcacgcgcacggcgccggcggccggtgac
gatgtcgcggtgaagttcgccttcgccagctgccaggactacatcggccgctactacaac
acgtggctgaagctgctgaagctggacgaggacctggacttcgtcgtgttcctcggcgac
tacatctacgagacgacgggcgacacgtcgttccagacgcccacgtccacgcgctccatc
acgttcagcgagccggaggcggcgctcaagcacggcacgggttcggtggcgttctacgcg
gccaactcgctgtccaactaccgcgacatctacaaggcgatccgctcggacaaggtcatc
cagcaggtccacgagcgctatcccttcatcgtcatgtgggacgaccacgagttctccgac
gacaactggggccccaacgcgacgtacacggatggcgtcaagaaggaggagcaggtcgac
cggaagaagaactccgagcgcgccttcttcgagtacatcccgctggacaacacgcaggcg
gcggagggcgccatcgacgtggcctccgcgccggtgtacccgaacacgctcatctaccgg
gacttcgagttcggcaagaacctgaagatggcggtgtccgacttccgcaccttccgtccg
gaccacctcatcccggaggacgcgtacccgggccaggtggcggtgacggcggaggtgctg
ggccagttcctgccgggcctgccggcgccggtgcaggggctgttgcagacggagacgttc
gcgtacgtgaacatcgacgcgccggagttcgccgcgcagaaggccgcgctgatgggcgcg
ttcgtggcggaggcgacgaagtcgggcctcacgcagggcgaggcgacggagcgggcccag
gcctccgtgaaggggagcctggcgctcttctacgtgaaccaggtactgaagaaggtgaac
gaggcgcgcgccgcggcgggtgccccggcgattcccgcgattgccgccacgggcgcgccc
cggggcctgtcctatgcgcacatgggcaaggcggggctcttcggcatccagggcacgcgc
tacatcgtcgtgaagcccatcttcgacctgttcgcgttcatccgctacacgctcacgcgt
ggcgcctccgaggacgcgctgggccaggcgcagcagacgtggctccagaaccagctcaag
gccaccaacacctggaagatcatcgtcagctccgtgtcgatgacgtccatggtgttcgac
ctgtcccagaagatggacatcccggaccccacgctgcgccagacgttctacttcaacgtg
gaccagtgggacggcttccccaccaagaagcaggagctgctgaagtacatccgggacaac
caggtgcagaacgcgctgttcgtctccggtgacatccacgcgtccttcgcgtcggtggag
tcgggggtgccctcgctgacggcgcccgcgatttcgtccggctccatcaaggagctggcg
ggcatggccgtcatcggtgcgggctacctgcagggcagcgccgtgcaccgctacgtcgtc
gccgagctgaacgagtcgctggccgcgggcaacccgggcatgcgctacgtgaacggcgac
gcgcacggcttcgtgattctggagctgaagggcaacgaagcgctggccgcctaccacctc
atccccagcaccgaggtgacgaaggactactcgctcaagacggacgcggagctggatgcg
cgcttcacgcgcgtggacttccgcgtcaccaacgggaccatcaccaagctgtag

DBGET integrated database retrieval system